HOXC12 Antibody

Images

 
Western Blot: HOXC12 Antibody [NBP1-68929] - Mouse Liver lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOXC12 Antibody Summary

Immunogen
Synthetic peptides corresponding to Hoxc12 (homeobox C12) The peptide sequence was selected from the N terminal of Hoxc12. Peptide sequence PLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLPWPSAEPCNG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HOXC12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Hoxc12 and was validated on Western blot.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HOXC12 Antibody

  • HOC3F
  • homeo box 3F
  • homeo box C12
  • homeobox C12
  • Homeobox protein Hox-3F
  • homeobox protein Hox-C12
  • HOX3FHOX3

Background

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45744
Species: Hu
Applications: WB, IHC
NBP2-55738
Species: Hu
Applications: ICC/IF
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-58710
Species: Hu
Applications: WB, ICC/IF
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
H00003237-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-14098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57662
Species: Hu
Applications: ICC/IF
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP2-47428
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83234
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
H00003204-M01
Species: Hu
Applications: WB, ELISA
NBP1-80228
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-58808
Species: Hu
Applications: WB, ICC/IF
AF6318
Species: Hu
Applications: ICC
NBP1-68929
Species: Mu
Applications: WB

Publications for HOXC12 Antibody (NBP1-68929) (0)

There are no publications for HOXC12 Antibody (NBP1-68929).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXC12 Antibody (NBP1-68929) (0)

There are no reviews for HOXC12 Antibody (NBP1-68929). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXC12 Antibody (NBP1-68929) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXC12 Products

Bioinformatics Tool for HOXC12 Antibody (NBP1-68929)

Discover related pathways, diseases and genes to HOXC12 Antibody (NBP1-68929). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXC12 Antibody (NBP1-68929)

Discover more about diseases related to HOXC12 Antibody (NBP1-68929).
 

Pathways for HOXC12 Antibody (NBP1-68929)

View related products by pathway.

PTMs for HOXC12 Antibody (NBP1-68929)

Learn more about PTMs related to HOXC12 Antibody (NBP1-68929).

Blogs on HOXC12

There are no specific blogs for HOXC12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXC12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXC12
Uniprot