HOXB9 Antibody (4C3)

Images

 
Western Blot: HOXB9 Antibody (4C3) [H00003219-M03] - Analysis of HOXB9 expression in transfected 293T cell line by HOXB9 monoclonal antibody (M03), clone 4C3. Lane 1: HOXB9 transfected lysatE (28.1 KDa). Lane 2: ...read more
Immunoprecipitation: HOXB9 Antibody (4C3) [H00003219-M03] - Analysis of HOXB9 transfected lysate using anti-HOXB9 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HOXB9 rabbit polyclonal antibody.
Sandwich ELISA: HOXB9 Antibody (4C3) [H00003219-M03] - Detection limit for recombinant GST tagged HOXB9 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
4C3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HOXB9 Antibody (4C3) Summary

Immunogen
HOXB9 (NP_076922.1 65 a.a. - 163 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEG
Specificity
HOXB9 (4C3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HOXB9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXB9 Antibody (4C3)

  • homeo box 2E
  • homeo box B9
  • homeobox B9
  • Homeobox protein Hox-2.5
  • Homeobox protein Hox-2E
  • homeobox protein Hox-B9
  • HOX-2.5
  • HOX2EHOX2

Background

This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of leukemia, prostate cancer and lung cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6318
Species: Hu
Applications: ICC
NBL1-11673
Species: Hu
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
NBP2-14098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56557
Species: Hu
Applications: ICC/IF
H00003204-M01
Species: Hu
Applications: WB, ELISA
NBP2-55738
Species: Hu
Applications: ICC/IF
NBP1-52085
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP1-81215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
NBP2-56537
Species: Hu
Applications: ICC/IF
NBL1-11664
Species: Hu
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
NBP2-45744
Species: Hu
Applications: WB, IHC
H00003223-M04
Species: Hu
Applications: WB, ELISA
NBP2-58710
Species: Hu
Applications: WB, ICC/IF
H00003219-M03
Species: Hu
Applications: WB, ELISA, IP

Publications for HOXB9 Antibody (H00003219-M03) (0)

There are no publications for HOXB9 Antibody (H00003219-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXB9 Antibody (H00003219-M03) (0)

There are no reviews for HOXB9 Antibody (H00003219-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXB9 Antibody (H00003219-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXB9 Products

Bioinformatics Tool for HOXB9 Antibody (H00003219-M03)

Discover related pathways, diseases and genes to HOXB9 Antibody (H00003219-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXB9 Antibody (H00003219-M03)

Discover more about diseases related to HOXB9 Antibody (H00003219-M03).
 

Pathways for HOXB9 Antibody (H00003219-M03)

View related products by pathway.

PTMs for HOXB9 Antibody (H00003219-M03)

Learn more about PTMs related to HOXB9 Antibody (H00003219-M03).

Blogs on HOXB9

There are no specific blogs for HOXB9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXB9 Antibody (4C3) and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXB9
Entrez
OMIM
Uniprot