HOXB9 Antibody (4C3) - Azide and BSA Free

Western Blot: HOXB9 Antibody (4C3) [H00003219-M03] - Analysis of HOXB9 expression in transfected 293T cell line by HOXB9 monoclonal antibody (M03), clone 4C3. Lane 1: HOXB9 transfected lysatE (28.1 KDa). Lane 2: Non-transfected lysate.

Immunoprecipitation: HOXB9 Antibody (4C3) [H00003219-M03] - Analysis of HOXB9 transfected lysate using anti-HOXB9 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HOXB9 rabbit polyclonal antibody.

Sandwich ELISA: HOXB9 Antibody (4C3) [H00003219-M03] - Detection limit for recombinant GST tagged HOXB9 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IP
• Clone: 4C3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

HOXB9 Antibody (4C3) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: HOXB9 (NP_076922.1, 65 a.a. ~ 163 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEG
• Specificity: HOXB9 (4C3)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HOXB9
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXB9 Antibody (4C3) - Azide and BSA Free

• homeo box 2E
• homeo box B9
• homeobox B9
• Homeobox protein Hox-2.5
• Homeobox protein Hox-2E
• homeobox protein Hox-B9
• HOX-2.5
• HOX2EHOX2

Background

This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of leukemia, prostate cancer and lung cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HOXB9
• Entrez:
  • 3219(Human)
• OMIM:
  • 142964(Human)
• Uniprot:
  • NP_076922(Human)