HOXB9 Antibody (3C8)

Western Blot: HOXB9 Antibody (3C8) [H00003219-M01] - HOXB9 monoclonal antibody (M01), clone 3C8 Analysis of HOXB9 expression in HepG2.

Sandwich ELISA: HOXB9 Antibody (3C8) [H00003219-M01] - Detection limit for recombinant GST tagged HOXB9 is 1 ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clone: 3C8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

HOXB9 Antibody (3C8) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: HOXB9 (NP_076922.1, 65 a.a. ~ 163 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEG
• Specificity: HOXB9 (3C8)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HOXB9
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXB9 Antibody (3C8)

• homeo box 2E
• homeo box B9
• homeobox B9
• Homeobox protein Hox-2.5
• Homeobox protein Hox-2E
• homeobox protein Hox-B9
• HOX-2.5
• HOX2EHOX2

Background

This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of leukemia, prostate cancer and lung cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HOXB9 Antibody (H00003219-M01)(1)

Publication using H00003219-M01

• Zhan J, Niu M, Wang P et al. Elevated HOXB9 expression promotes differentiation and predicts a favourable outcome in colon adenocarcinoma patients. Br J Cancer. 2014-07-15 [PMID: 25025961]

Bioinformatics

• Gene Symbol: HOXB9
• Entrez:
  • 3219(Human)
• OMIM:
  • 142964(Human)
• Uniprot:
  • NP_076922(Human)