HOXB5 Antibody (3F10)

Images

 
Western Blot: HOXB5 Antibody (3F10) [H00003215-M01] - Analysis of HOXB5 expression in transfected 293T cell line by HOXB5 monoclonal antibody (M01), clone 3F10.Lane 1: HOXB5 transfected lysate(29.4 KDa).Lane 2: ...read more
ELISA: HOXB5 Antibody (3F10) [H00003215-M01] - Detection limit for recombinant GST tagged HOXB5 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3F10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HOXB5 Antibody (3F10) Summary

Immunogen
HOXB5 (NP_002138.1 170 a.a. - 267 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EGQTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSLATAGSAF
Specificity
HOXB5 - homeobox B5 (3F10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HOXB5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXB5 Antibody (3F10)

  • HHO.C10
  • homeo box 2A
  • homeo box B5
  • homeobox B5
  • Homeobox protein HHO.C10
  • Homeobox protein Hox-2A
  • homeobox protein Hox-B5
  • Homeobox protein Hu-1
  • Hox2.1
  • HOX2AHOX2
  • HU-1

Background

This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-11673
Species: Hu
NBP2-52555
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
AF6318
Species: Hu
Applications: ICC
NBP2-57662
Species: Hu
Applications: ICC/IF
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
H00003204-M01
Species: Hu
Applications: WB, ELISA
NBP2-14098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56537
Species: Hu
Applications: ICC/IF
H00003223-M04
Species: Hu
Applications: WB, ELISA
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56195
Species: Hu
Applications: WB, ICC/IF
NBP1-83234
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003215-M01
Species: Hu
Applications: WB, ELISA

Publications for HOXB5 Antibody (H00003215-M01) (0)

There are no publications for HOXB5 Antibody (H00003215-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXB5 Antibody (H00003215-M01) (0)

There are no reviews for HOXB5 Antibody (H00003215-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXB5 Antibody (H00003215-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXB5 Products

Bioinformatics Tool for HOXB5 Antibody (H00003215-M01)

Discover related pathways, diseases and genes to HOXB5 Antibody (H00003215-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXB5 Antibody (H00003215-M01)

Discover more about diseases related to HOXB5 Antibody (H00003215-M01).
 

Pathways for HOXB5 Antibody (H00003215-M01)

View related products by pathway.

PTMs for HOXB5 Antibody (H00003215-M01)

Learn more about PTMs related to HOXB5 Antibody (H00003215-M01).

Blogs on HOXB5

There are no specific blogs for HOXB5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXB5 Antibody (3F10) and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXB5
Entrez
Uniprot