HOXB4 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

HOXB4 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HOXB4.
  
  

  Source: E. coli

  Amino Acid Sequence: CEAVSSSPPPPPCAQNPLHPSPSHSACKEPVVY

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: HOXB4
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33833.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 21 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HOXB4 Recombinant Protein Antigen

• homeo box 2F
• homeo box B4
• homeobox B4
• Homeobox protein Hox-2.6
• Homeobox protein Hox-2F
• homeobox protein Hox-B4
• HOX-2.6
• HOX2FHOX2

Background

Homebox transcription factors (Hox) are encoded by highly conserved developmental genes that are involved embryonic and early hematopoietic development. Specifically, Homeobox B4 (HoxB4) is a transcription factor encoded by HOXB4 gene and it is involved in the developmental regulation of specific positional identities on the anterior-posterior axis of cells. Like all members of HOX family, HoXB4 is abundantly expressed in primitive hematopoietic stem cell (HSC), but then decline with lineage-specific terminal differentiation (1). In HSC, stem cell self-renewal activity is regulated by USF1/2 binding to HoxB4, where binding possibly favors stem cell self-renewal instead of cell differentiation. Jun-B and Fra-1 has been linked as key mediators during cell proliferation and differentiation induced by HoxB4, which leads to increase expression of Cyclin D1 and G1 shortening (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: HOXB4