We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

HOXB4 Recombinant Protein Antigen

Images

 
There are currently no images for HOXB4 Protein (NBP2-33833PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HOXB4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HOXB4.

Source: E. coli

Amino Acid Sequence: CEAVSSSPPPPPCAQNPLHPSPSHSACKEPVVY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HOXB4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33833.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HOXB4 Recombinant Protein Antigen

  • homeo box 2F
  • homeo box B4
  • homeobox B4
  • Homeobox protein Hox-2.6
  • Homeobox protein Hox-2F
  • homeobox protein Hox-B4
  • HOX-2.6
  • HOX2FHOX2

Background

Homebox transcription factors (Hox) are encoded by highly conserved developmental genes that are involved embryonic and early hematopoietic development. Specifically, Homeobox B4 (HoxB4) is a transcription factor encoded by HOXB4 gene and it is involved in the developmental regulation of specific positional identities on the anterior-posterior axis of cells. Like all members of HOX family, HoXB4 is abundantly expressed in primitive hematopoietic stem cell (HSC), but then decline with lineage-specific terminal differentiation (1). In HSC, stem cell self-renewal activity is regulated by USF1/2 binding to HoxB4, where binding possibly favors stem cell self-renewal instead of cell differentiation. Jun-B and Fra-1 has been linked as key mediators during cell proliferation and differentiation induced by HoxB4, which leads to increase expression of Cyclin D1 and G1 shortening (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002523-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB600-1071
Species: Hu(-), Mu
Applications: COMET, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, mIF, WB
NBP3-09362
Species: Hu
Applications: WB
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-13937
Species: Hu
Applications: ELISA, Flow, ICC/IF,  IHC-P, IP, PA, WB
288-TPN/CF
Species: Hu
Applications: BA
NBP3-47382
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
NBP3-15720
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-54948
Species: Hu
Applications: ICC/IF
NBP2-32515
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF6318
Species: Hu
Applications: ICC
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
H00003204-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-24597
Species: Ch, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
314-BP
Species: Hu
Applications: BA, BA
NBP1-96140
Species: Hu, Mu
Applications: ChIP, Flow-IC, Flow, ICC/IF, IP, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-83235
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P, WB

Publications for HOXB4 Protein (NBP2-33833PEP) (0)

There are no publications for HOXB4 Protein (NBP2-33833PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXB4 Protein (NBP2-33833PEP) (0)

There are no reviews for HOXB4 Protein (NBP2-33833PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HOXB4 Protein (NBP2-33833PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HOXB4 Products

Blogs on HOXB4

There are no specific blogs for HOXB4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HOXB4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXB4