Recombinant Human Hoxb3 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Hoxb3 Protein [H00003213-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human Hoxb3 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 272-370 of Human Hoxb3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TAGFMNALHSMTPSYESPSPPAFGKAHQNAYALPSNYQPPLKGCGAPQKYPPTPAPEYEPHVLQANGGAYGTPTMQGSPVYVGGGGYADPLPPPAGPSL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
HOXB3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Hoxb3 GST (N-Term) Protein

  • homeo box 2G
  • homeobox B3
  • Homeobox protein Hox-2.7
  • Homeobox protein Hox-2G
  • homeobox protein Hox-B3
  • HOX2
  • Hox-2.7
  • HOX2Ghomeo box B3

Background

This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83234
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24561
Species: Bv, Fe, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
H00003232-M09
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
NBP2-32356
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF6318
Species: Hu
Applications: ICC
NB110-59723
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
H00003223-M04
Species: Hu
Applications: ELISA, WB
NBP3-13937
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
NBP2-42520
Species: Hu, Po
Applications: IHC-P, PEP-ELISA, WB
H00003215-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
NBP2-32515
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00003204-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP2-83054
Species: Hu
Applications: WB
NBP2-24597
Species: Ch, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-87596
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-04877
Species: Hu, Mu, Rt
Applications: WB
NBP2-46001
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00003213-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for Hoxb3 Partial Recombinant Protein (H00003213-Q01) (0)

There are no publications for Hoxb3 Partial Recombinant Protein (H00003213-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hoxb3 Partial Recombinant Protein (H00003213-Q01) (0)

There are no reviews for Hoxb3 Partial Recombinant Protein (H00003213-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hoxb3 Partial Recombinant Protein (H00003213-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Hoxb3 Products

Array H00003213-Q01

Bioinformatics Tool for Hoxb3 Partial Recombinant Protein (H00003213-Q01)

Discover related pathways, diseases and genes to Hoxb3 Partial Recombinant Protein (H00003213-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hoxb3 Partial Recombinant Protein (H00003213-Q01)

Discover more about diseases related to Hoxb3 Partial Recombinant Protein (H00003213-Q01).
 

Pathways for Hoxb3 Partial Recombinant Protein (H00003213-Q01)

View related products by pathway.

PTMs for Hoxb3 Partial Recombinant Protein (H00003213-Q01)

Learn more about PTMs related to Hoxb3 Partial Recombinant Protein (H00003213-Q01).

Blogs on Hoxb3

There are no specific blogs for Hoxb3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Hoxb3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXB3