Hoxb3 Antibody

Product Discontinued

Hoxb3 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MQKATYYDNAAAALFGGYSSYPGSNGFGFDVPPQPPFQAATHLEGDYQRSACSLQSLGNAAPHAKSKEL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HOXB3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1-4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Hoxb3 Antibody

• homeo box 2G
• homeobox B3
• Homeobox protein Hox-2.7
• Homeobox protein Hox-2G
• homeobox protein Hox-B3
• HOX2
• Hox-2.7
• HOX2Ghomeo box B3

Background

Hoxb3 is a transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. HoxB3 plays a role in the proliferation and differentiation of both early myeloid and lymphoid developmental pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HOXB3