HOXA6 Antibody (3A6)

Images

 
Sandwich ELISA: HOXA6 Antibody (3A6) [H00003203-M01] - Detection limit for recombinant GST tagged HOXA6 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3A6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HOXA6 Antibody (3A6) Summary

Immunogen
HOXA6 (NP_076919, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQGKALHDEGADR
Specificity
HOXA6 - homeobox A6 (3A6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HOXA6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00003203-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXA6 Antibody (3A6)

  • homeo box A6
  • homeobox A6
  • Homeobox protein Hox-1B
  • homeobox protein HOXA6
  • homeobox protein Hox-A6
  • HOX1
  • HOX1.2
  • HOX1Bhomeo box 1B

Background

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82991
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
NBP2-42520
Species: Hu, Po
Applications: WB, IHC-P, PEP-ELISA
NBP2-32356
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003204-M01
Species: Hu
Applications: WB, ELISA, S-ELISA
NBP2-46001
Species: Hu
Applications: WB, IHC, IHC-P
H00003231-M01
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
NBP2-32515
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11664
Species: Hu
H00003213-Q01
Species: Hu
NBP2-85076
Species: Hu
Applications: WB
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
H00003237-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-45744
Species: Hu
Applications: WB, IHC
H00003223-M04
Species: Hu
Applications: WB, ELISA, S-ELISA
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC, IHC-P
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
H00003216-M01-100ug
Species: Hu
Applications: WB, ELISA, S-ELISA
NBP2-56537
Species: Hu
Applications: ICC/IF

Publications for HOXA6 Antibody (H00003203-M01)(1)

Reviews for HOXA6 Antibody (H00003203-M01) (0)

There are no reviews for HOXA6 Antibody (H00003203-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXA6 Antibody (H00003203-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HOXA6 Products

Bioinformatics Tool for HOXA6 Antibody (H00003203-M01)

Discover related pathways, diseases and genes to HOXA6 Antibody (H00003203-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXA6 Antibody (H00003203-M01)

Discover more about diseases related to HOXA6 Antibody (H00003203-M01).
 

Pathways for HOXA6 Antibody (H00003203-M01)

View related products by pathway.

PTMs for HOXA6 Antibody (H00003203-M01)

Learn more about PTMs related to HOXA6 Antibody (H00003203-M01).

Blogs on HOXA6

There are no specific blogs for HOXA6, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXA6 Antibody (3A6) and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXA6
Entrez
Uniprot