Home » HOXA6 » HOXA6 Antibodies » HOXA6 Antibody (3A6)

HOXA6 Antibody (3A6)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Sandwich ELISA: HOXA6 Antibody (3A6) [H00003203-M01] - Detection limit for recombinant GST tagged HOXA6 is approximately 1ng/ml as a capture antibody.
Sandwich ELISA: HOXA6 Antibody (3A6) [H00003203-M01] - Detection limit for recombinant GST tagged HOXA6 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3A6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

HOXA6 Antibody (3A6) Summary

Immunogen
HOXA6 (NP_076919, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQGKALHDEGADR
Specificity
HOXA6 - homeobox A6 (3A6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HOXA6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00003203-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXA6 Antibody (3A6)

  • homeo box A6
  • homeobox A6
  • Homeobox protein Hox-1B
  • homeobox protein HOXA6
  • homeobox protein Hox-A6
  • HOX1
  • HOX1.2
  • HOX1Bhomeo box 1B

Background

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ZEB2 Antibody
NBP1-82991
Western Blot: ZEB2 Antibody [NBP1-82991] - Analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-ZEB2 antibody. Corresponding ZEB2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human pancreas shows no positivity as expected.
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human cerebral cortex shows moderate nuclear positivity in glial cells.
(2 Reviews)
(16 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
HOXA5 Antibody
NBP2-42520
Western Blot: HOXA5 Antibody [NBP2-42520] - Staining of Pig Kidney lysate with antibody at 1 ug/mL (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: HOXA5 Antibody [NBP2-42520] - Staining of paraffin embedded Human Prostate. Antibody at 5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu, Po
Applications: WB, IHC-P, PEP-ELISA
HOXA9 Antibody
NBP2-32356
Western Blot: HOXA9 Antibody [NBP2-32356] - Analysis in human cell line HEK 293 and human cell line MCF-7.
Immunocytochemistry/Immunofluorescence: HOXA9 Antibody [NBP2-32356] - Staining of human cell line HEK 293 shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human cerebral cortex shows moderate nuclear and cytoplasmic positivity in neuronal cells, glial cells were strongly stained..
(4 Publications)
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
HOXA7 Antibody
(2F2)
H00003204-M01
Western Blot: HOXA7 Antibody (2F2) [H00003204-M01] - Analysis of HOXA7 expression in transfected 293T cell line by HOXA7 monoclonal antibody (M01), clone 2F2.Lane 1: HOXA7 transfected lysate(25.4 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: HOXA7 Antibody (2F2) [H00003204-M01] - Detection limit for recombinant GST tagged HOXA7 is approximately 0.1ng/ml as a capture antibody.
(1 Publication)
Species: Hu
Applications: WB, ELISA, S-ELISA
HOXD4 Antibody
(OTI1E9)
NBP2-46001
Western Blot: HOXD4 Antibody (OTI1E9) [NBP2-46001] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY HOXD4 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-HOXD4.
Immunohistochemistry-Paraffin: HOXD4 Antibody (OTI1E9) [NBP2-46001] - Staining of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-HOXD4 mouse monoclonal antibody.
Species: Hu
Applications: WB, IHC, IHC-P
HOXD1 Antibody
(4F4)
H00003231-M01
Western Blot: HOXD1 Antibody (4F4) [H00003231-M01] - Analysis of HOXD1 expression in transfected 293T cell line by HOXD1 monoclonal antibody (M01), clone 4F4.Lane 1: HOXD1 transfected lysate(34.1 KDa).Lane 2: Non-transfected lysate.
Immunoprecipitation: HOXD1 Antibody (4F4) [H00003231-M01] - Analysis of HOXD1 transfected lysate using anti-HOXD1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HOXD1 MaxPab rabbit polyclonal antibody.
Sandwich ELISA: HOXD1 Antibody (4F4) [H00003231-M01] - Detection limit for recombinant GST tagged HOXD1 is 0.1 ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
HOXA4 Antibody
NBP2-32515
Western Blot: HOXA4 Antibody [NBP2-32515] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: HOXA4 Antibody [NBP2-32515] - Immunofluorescent staining of human cell line HEK 293 shows localization to nuclear bodies.
Immunohistochemistry-Paraffin: HOXA4 Antibody [NBP2-32515] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
HOXA10
Overexpression Lysate
NBL1-11664
Western Blot: HOXA10 Overexpression Lysate (Adult Normal) [NBL1-11664] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for HOXA10.
Species: Hu
Recombinant Human
Hoxb3 Protein
H00003213-Q01
SDS-Page: Recombinant Human Hoxb3 Protein [H00003213-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
HOXD9 Antibody
NBP2-85076
Western Blot: HOXD9 Antibody [NBP2-85076] - WB Suggested Anti-HOXD9 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Spleen
Western Blot: HOXD9 Antibody [NBP2-85076] - Host: Rabbit. Target: HOXD9. Positive control (+): 293T Cell Lysate (2T). Negative control (-): Human Lung (LU). Antibody concentration: 2ug/ml
Species: Hu
Applications: WB
HOXD8 Antibody
NBP2-27108
Western Blot: HOXD8 Antibody [NBP2-27108] - Analysis of HOXD8 in T98G cell lysate in the 1) pre-bleed at 1:5000 dilution 2) T98G cell lysate and 3) NIH 3T3 cell lysate using this antibody. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Species: Hu, Mu, Pm
Applications: WB
HOXD3 Antibody
(1B12)
H00003232-M09
Western Blot: HOXD3 Antibody (1B12) [H00003232-M09] - Analysis of HOXD3 expression in Hela S3 NE (Cat # L013V3).
Immunocytochemistry/Immunofluorescence: HOXD3 Antibody (1B12) [H00003232-M09] - Analysis of monoclonal antibody to HOXD3 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: HOXD3 Antibody (1B12) [H00003232-M09] - Detection limit for recombinant GST tagged HOXD3 is approximately 10ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
HOXD11 Antibody
(6C8)
H00003237-M10
Western Blot: HOXD11 Antibody (6C8) [H00003237-M10] - Analysis of HOXD11 expression in K-562 (Cat # L009V1).
Immunocytochemistry/Immunofluorescence: HOXD11 Antibody (6C8) [H00003237-M10] - Analysis of monoclonal antibody to HOXD11 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: HOXD11 Antibody (6C8) [H00003237-M10] - Analysis of monoclonal antibody to HOXD11 on formalin-fixed paraffin-embedded human colon. Antibody concentration 0.7 ug/ml
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
HOXD10 Antibody
(OTI1D11)
NBP2-45744
Western Blot: HOXD10 Antibody (1D11) [NBP2-45744] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY HOXD10.
Immunohistochemistry: HOXD10 Antibody (1D11) [NBP2-45744] - Analysis of Carcinoma of Human bladder tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: HOXD10 Antibody (1D11) [NBP2-45744] - Analysis of Carcinoma of Human pancreas tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Hu
Applications: WB, IHC
Sonic Hedgehog/Shh
[Unconjugated]
1845-SH
1 μg/lane of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 22 kDa.
MALDI-TOF analysis of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus. The major peak corresponds to the calculated molecular mass, 19814 Da. The minor peak at 20029  is a matrix-associated artifact of the MALDI-TOF.
Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus (Catalog # 1845-SH) induces alkaline phosphatase production by the C3H10T1/2 mouse embryonic fibroblast cell line. The ED50 for this effect is 0.1‑0.4 μg/mL.
(34 Publications)
Species: Hu
HOXC6 Antibody
(2A4)
H00003223-M04
Western Blot: HOXC6 Antibody (2A4) [H00003223-M04] - Analysis of HOXC6 expression in Hela S3 NE.
ELISA: HOXC6 Antibody (2A4) [H00003223-M04] - Detection limit for recombinant GST tagged HOXC6 is 0.1 ng/ml as a capture antibody.
(1 Publication)
Species: Hu
Applications: WB, ELISA, S-ELISA
HOXB4 Antibody
NBP2-24561
Western Blot: HOXB4 Antibody [NBP2-24561] - Analysis of HOXB4 in K562 cell lysate in the 1) absence and 2) presence of immunizing peptide using this antibody. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: HOXB4 Antibody [NBP2-24561] - Analysis of HOXB4 in formalin-fixed, paraffin-embedded human brain tissue using an isotype control (top left) and this antibody (bottom left, right) at 5 ug/ml.
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC, IHC-P
PDX-1/IPF1
Antibody [Unconjugate
AF2419
Western blot shows lysates of beta TC‑6 mouse beta cell insulinoma cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human PDX‑1/IPF1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2419) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for PDX‑1/IPF1 at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
PDX‑1/IPF1 was detected in immersion fixed BG01V human embryonic stem cells differentiated into pancreatic progenitor cells using Goat Anti-Human PDX‑1/IPF1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 493-conjugated Anti-Goat IgG Secondary Antibody (green; Catalog # NL003) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
Simple Western lane view shows lysates of beta TC‑6 mouse beta cell insulinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for PDX‑1/IPF1 at approximately 48 kDa (as indicated) using 10 µg/mL of Goat Anti-Human PDX‑1/IPF1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2419) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(21 Publications)
Species: Hu
Applications: WB, Simple Western, IHC, ICC
HOXB6 Antibody
(8E3)
H00003216-M01-100ug
Western Blot: HOXB6 Antibody (8E3) [H00003216-M01-100ug] - Detection against Immunogen (32.01 KDa)
Western Blot: HOXB6 Antibody (8E3) [H00003216-M01-100ug] - Analysis of HOXB6 expression in transfected 293T cell line by HOXB6 monoclonal antibody (M01), clone 8E3. Lane 1: HOXB6 transfected lysate (Predicted MW: 25.4 KDa). Lane 2: Non-transfected lysate.
ELISA: HOXB6 Antibody (8E3) [H00003216-M01-100ug] - Detection limit for recombinant GST tagged HOXB6 is 0.03 ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, S-ELISA
HOXB8 Antibody
NBP2-56537
Immunocytochemistry/Immunofluorescence: HOXB8 Antibody [NBP2-56537] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm.
Species: Hu
Applications: ICC/IF

Publications for HOXA6 Antibody (H00003203-M01)(1)


Reviews for HOXA6 Antibody (H00003203-M01) (0)

There are no reviews for HOXA6 Antibody (H00003203-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXA6 Antibody (H00003203-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional HOXA6 Products

Bioinformatics Tool for HOXA6 Antibody (H00003203-M01)

Discover related pathways, diseases and genes to HOXA6 Antibody (H00003203-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXA6 Antibody (H00003203-M01)

Discover more about diseases related to HOXA6 Antibody (H00003203-M01).
 

Pathways for HOXA6 Antibody (H00003203-M01)

View related products by pathway.

PTMs for HOXA6 Antibody (H00003203-M01)

Learn more about PTMs related to HOXA6 Antibody (H00003203-M01).

Blogs on HOXA6

There are no specific blogs for HOXA6, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXA6 Antibody (3A6) and receive a gift card or discount.


Bioinformatics

Gene Symbol HOXA6
Entrez
Uniprot