Recombinant Human HOXA3 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human HOXA3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-77 of Human HOXA3

Source: Wheat Germ

Amino Acid Sequence: MQKATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPACSLQSPSSAGGHPKAHELSEACLRTLSA

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
HOXA3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
34.21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HOXA3 Protein

  • homeo box A3
  • homeobox A3
  • Homeobox protein Hox-1E
  • homeobox protein Hox-A3
  • HOX1
  • Hox-1.5-like protein
  • HOX1Ehomeo box 1E
  • MGC10155

Background

HOXA3 - homeo box A3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-11666
Species: Hu
H00003213-Q01
Species: Hu
NB100-92327
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF6318
Species: Hu
Applications: ICC
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-58710
Species: Hu
Applications: WB, ICC/IF
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
NBP2-45744
Species: Hu
Applications: WB, IHC
NBP2-56905
Species: Hu
Applications: WB, ICC/IF
NBP2-04309
Species: Hu
NBP2-14098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003221-M01
Species: Hu
Applications: WB, ELISA, RNAi
NBP1-52085
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP2-56557
Species: Hu
Applications: ICC/IF
NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
H00003200-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for HOXA3 Partial Recombinant Protein (H00003200-Q01) (0)

There are no publications for HOXA3 Partial Recombinant Protein (H00003200-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXA3 Partial Recombinant Protein (H00003200-Q01) (0)

There are no reviews for HOXA3 Partial Recombinant Protein (H00003200-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXA3 Partial Recombinant Protein (H00003200-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for HOXA3 Partial Recombinant Protein (H00003200-Q01)

Discover related pathways, diseases and genes to HOXA3 Partial Recombinant Protein (H00003200-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXA3 Partial Recombinant Protein (H00003200-Q01)

Discover more about diseases related to HOXA3 Partial Recombinant Protein (H00003200-Q01).
 

Pathways for HOXA3 Partial Recombinant Protein (H00003200-Q01)

View related products by pathway.

PTMs for HOXA3 Partial Recombinant Protein (H00003200-Q01)

Learn more about PTMs related to HOXA3 Partial Recombinant Protein (H00003200-Q01).

Blogs on HOXA3

There are no specific blogs for HOXA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HOXA3 Antibody
NBP1-83234

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HOXA3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXA3