After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.
Immunocytochemistry/ Immunofluorescence: HOXA3 Antibody [NBP1-83234] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HOXA3 Antibody [NBP1-83234] - Staining of human tonsil shows weak to moderate nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: HOXA3 Antibody [NBP1-83234] - Staining of human fallopian tube shows moderate nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: HOXA3 Antibody [NBP1-83234] - Staining of human pancreas shows no nuclear positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: HOXA3 Antibody [NBP1-83234] - Staining of human testis shows weak to moderate nuclear positivity in a subset of cells in seminiferous ducts.
Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!
Or feel free to contact us for alternative products.
Datasheet
Reviews & Publications
Protocols & FAQs
Support & Research
HOXA3 Antibody Summary
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPACSLQSPSSAGGHPKAHELSEACLRTLSAPPSQP
Localization
Nucleus
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HOXA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
ICC/IF reported in scientific literature (PMID: 23684540). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Publications
Read Publication using NBP1-83234 in the following applications:
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%)
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for HOXA3 Antibody
homeo box A3
homeobox A3
Homeobox protein Hox-1E
homeobox protein Hox-A3
HOX1
Hox-1.5-like protein
HOX1Ehomeo box 1E
MGC10155
Background
HOXA3 is 443 amino acids long, weighing approximately 46 kDa, that functions as a sequence-specific transcription factor which focuses on the specific positional identities of cells on the anterior-posterior axis, which is all part of a developmental regulatory system. Current studies are being done on several diseases and disorders including teratocarcinoma, pharyngitis, esophagitis, and thyroiditis. HOXA3 has also been shown to have interactions with ALX4, PWP1, SOX10, SEC23B, and E2F4.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our HOXA3 Antibody and receive a gift card or discount.