HOXA3 Antibody

Immunocytochemistry/Immunofluorescence: HOXA3 Antibody [NBP1-83234] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: HOXA3 Antibody [NBP1-83234] - Staining of human tonsil shows weak to moderate nuclear positivity in germinal center cells.

Immunohistochemistry-Paraffin: HOXA3 Antibody [NBP1-83234] - Staining of human fallopian tube shows moderate nuclear positivity in a subset of glandular cells.

Immunohistochemistry-Paraffin: HOXA3 Antibody [NBP1-83234] - Staining of human pancreas shows no nuclear positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: HOXA3 Antibody [NBP1-83234] - Staining of human testis shows weak to moderate nuclear positivity in a subset of cells in seminiferous ducts.

Product Discontinued

HOXA3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPACSLQSPSSAGGHPKAHELSEACLRTLSAPPSQP
• Localization: Nucleus
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HOXA3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: ICC/IF reported in scientific literature (PMID: 23684540). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HOXA3 Antibody

• homeo box A3
• homeobox A3
• Homeobox protein Hox-1E
• homeobox protein Hox-A3
• HOX1
• Hox-1.5-like protein
• HOX1Ehomeo box 1E
• MGC10155

Background

HOXA3 is 443 amino acids long, weighing approximately 46 kDa, that functions as a sequence-specific transcription factor which focuses on the specific positional identities of cells on the anterior-posterior axis, which is all part of a developmental regulatory system. Current studies are being done on several diseases and disorders including teratocarcinoma, pharyngitis, esophagitis, and thyroiditis. HOXA3 has also been shown to have interactions with ALX4, PWP1, SOX10, SEC23B, and E2F4.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HOXA3 Antibody (NBP1-83234)(1)

Publication using NBP1-83234

• Parent AV, Russ HA, Khan IS et al. Generation of functional thymic epithelium from human embryonic stem cells that supports host T cell development. Cell Stem Cell. 2013-08-01 [PMID: 23684540] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: HOXA3
• Entrez:
  • 3200(Human)
• Uniprot:
  • O43365(Human)