HOXA3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HOXA3 Antibody [NBP1-83234] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HOXA3 Antibody [NBP1-83234] - Staining of human tonsil shows weak to moderate nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: HOXA3 Antibody [NBP1-83234] - Staining of human fallopian tube shows moderate nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: HOXA3 Antibody [NBP1-83234] - Staining of human pancreas shows no nuclear positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: HOXA3 Antibody [NBP1-83234] - Staining of human testis shows weak to moderate nuclear positivity in a subset of cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOXA3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPACSLQSPSSAGGHPKAHELSEACLRTLSAPPSQP
Localization
Nucleus
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HOXA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
ICC/IF reported in scientific literature (PMID: 23684540). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HOXA3 Protein (NBP1-83234PEP)
Publications
Read Publication using
NBP1-83234 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HOXA3 Antibody

  • homeo box A3
  • homeobox A3
  • Homeobox protein Hox-1E
  • homeobox protein Hox-A3
  • HOX1
  • Hox-1.5-like protein
  • HOX1Ehomeo box 1E
  • MGC10155

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-83054
Species: Hu
Applications: WB
H00003213-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB110-59723
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
H00003232-M09
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF6318
Species: Hu
Applications: ICC
NBP2-46001
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
1845-SH/CF
Species: Hu
Applications: BA
H00003231-M01
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP2-24561
Species: Bv, Fe, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-45744
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-83055
Species: Hu
Applications: WB
NBP3-12330
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
H00003217-M03
Species: Hu, Rb
Applications: ELISA, Func, IHC, IHC-P, WB
NBP2-56195
Species: Hu
Applications: ICC/IF, WB
NBP1-52085
Species: Hu, Mu
Applications: PEP-ELISA, WB
NBP2-87596
Species: Hu
Applications: IHC, IHC-P, WB
423-F8
Species: Hu, Mu
Applications: BA
NBP2-42520
Species: Hu, Po
Applications: IHC-P, PEP-ELISA, WB
NBP1-83234
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for HOXA3 Antibody (NBP1-83234)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for HOXA3 Antibody (NBP1-83234) (0)

There are no reviews for HOXA3 Antibody (NBP1-83234). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HOXA3 Antibody (NBP1-83234) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXA3 Products

Bioinformatics Tool for HOXA3 Antibody (NBP1-83234)

Discover related pathways, diseases and genes to HOXA3 Antibody (NBP1-83234). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXA3 Antibody (NBP1-83234)

Discover more about diseases related to HOXA3 Antibody (NBP1-83234).
 

Pathways for HOXA3 Antibody (NBP1-83234)

View related products by pathway.

PTMs for HOXA3 Antibody (NBP1-83234)

Learn more about PTMs related to HOXA3 Antibody (NBP1-83234).

Blogs on HOXA3

There are no specific blogs for HOXA3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXA3
Entrez
Uniprot