HOXA3 Antibody


Western Blot: HOXA3 Antibody [NBP1-83234] - Analysis in control (vector only transfected HEK293T lysate) and hOXA3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: HOXA3 Antibody [NBP1-83234] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: HOXA3 Antibody [NBP1-83234] - Staining of human tonsil shows moderate nuclear positivity in reaction center cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

HOXA3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPACSLQSPSSAGGHPKAHELSEACLRTLSAPPSQP
Specificity of human HOXA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HOXA3 Protein (NBP1-83234PEP)
Read Publication using
NBP1-83234 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for HOXA3 Antibody

  • homeo box A3
  • homeobox A3
  • Homeobox protein Hox-1E
  • homeobox protein Hox-A3
  • HOX1
  • Hox-1.5-like protein
  • HOX1Ehomeo box 1E
  • MGC10155


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, PEP-ELISA
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HOXA3 Antibody (NBP1-83234)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for HOXA3 Antibody (NBP1-83234) (0)

There are no reviews for HOXA3 Antibody (NBP1-83234). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HOXA3 Antibody (NBP1-83234) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HOXA3 Products

Bioinformatics Tool for HOXA3 Antibody (NBP1-83234)

Discover related pathways, diseases and genes to HOXA3 Antibody (NBP1-83234). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXA3 Antibody (NBP1-83234)

Discover more about diseases related to HOXA3 Antibody (NBP1-83234).

Pathways for HOXA3 Antibody (NBP1-83234)

View related products by pathway.

PTMs for HOXA3 Antibody (NBP1-83234)

Learn more about PTMs related to HOXA3 Antibody (NBP1-83234).

Blogs on HOXA3

There are no specific blogs for HOXA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HOXA3 Antibody and receive a gift card or discount.


Gene Symbol HOXA3