Novus Biologicals products are now on bio-techne.com

HMX2 Antibody (1B10)

Images

 
Immunohistochemistry-Paraffin: HMX2 Antibody (1B10) [H00003167-M07] - Analysis of monoclonal antibody to HMX2 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 3 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC
Clone
1B10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HMX2 Antibody (1B10) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
HMX2 (NP_005510, 125 a.a. ~ 224 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PAGSPSPGSERPRDGGAERQAGAAKKKTRTVFSRSQVYQLESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQLSAELEAANMAHASAQT
Specificity
HMX2 (1B10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HMX2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HMX2 Antibody (1B10)

  • H6 family homeobox 2
  • H6 homeo box 2
  • H6L
  • homeo box (H6 family) 2
  • homeobox (H6 family) 2
  • Homeobox protein H6 family member 2
  • homeobox protein HMX2
  • Nkx5-2

Background

Transcription factor involved in specification of neuronal cell types and which is required for inner ear andhypothalamus development

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69011
Species: Hu, Mu
Applications: WB
NB200-331
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
H00003166-B01P-50ug
Species: Hu
Applications: WB
AF3364
Species: Hu
Applications: ICC, IHC, WB
NB100-56519
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NBP2-84979
Species: Hu
Applications: IHC, IHC-P, WB
345-FG
Species: Hu
Applications: BA
1206-F3
Species: Hu
Applications: BA
NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP3-09207
Species: Mu
Applications: WB
AF641
Species: Mu
Applications: IHC, WB
NBP2-50465
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
AF6470
Species: Hu, Mu
Applications: IHC, WB
AF3075
Species: Hu
Applications: ICC, Simple Western, WB
MAB6700
Species: Hu
Applications: CyTOF-ready, Flow
NB600-488
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

Publications for HMX2 Antibody (H00003167-M07) (0)

There are no publications for HMX2 Antibody (H00003167-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HMX2 Antibody (H00003167-M07) (0)

There are no reviews for HMX2 Antibody (H00003167-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HMX2 Antibody (H00003167-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HMX2 Antibody (1B10) and receive a gift card or discount.

Bioinformatics

Gene Symbol HMX2
Entrez
OMIM
Uniprot