Reactivity | HuSpecies Glossary |
Applications | WB, ELISA, IHC, IHC-P |
Clone | 1B10 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | HMX2 (NP_005510, 125 a.a. ~ 224 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PAGSPSPGSERPRDGGAERQAGAAKKKTRTVFSRSQVYQLESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQLSAELEAANMAHASAQT |
Specificity | HMX2 (1B10) |
Isotype | IgG2a Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | HMX2 |
Purity | IgG purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA. |
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | In 1x PBS, pH 7.4 |
Preservative | No Preservative |
Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Diseases for HMX2 Antibody (H00003167-M07)Discover more about diseases related to HMX2 Antibody (H00003167-M07).
| Pathways for HMX2 Antibody (H00003167-M07)View related products by pathway.
|
PTMs for HMX2 Antibody (H00003167-M07)Learn more about PTMs related to HMX2 Antibody (H00003167-M07).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.