Forkhead box I2 Antibody - BSA Free

Western Blot: Forkhead box I2 Antibody [NBP3-09207] - Western blot analysis of Forkhead box I2 in NIH/3T3 cell lysate as a positive control. Antibody dilution at 0.2-1 ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Forkhead box I2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_899016). Peptide sequence FDNGNFRRKRRRRGETSEAAVPGASSPEGTALEPRGSTPQDPQTSPSPSE
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FOXI2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Forkhead box I2 Antibody - BSA Free

• FLJ46831
• forkhead box I2
• forkhead box protein I2
• homolog of mouse Foxi2

Background

Forkhead box I2 is one of a range of Investigative Grade antibodies, made against targets that have limited or no commercial antibodies available to them and for which there are no data on the expression of the protein in the range of common cell lines and tissues available to us. These antibodies are affinity purified using their peptide immunogen and are known to give low background staining in a western blot. However no additional claims are made for their ability to recognise native protein in any application.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FOXI2