HMGCL Antibody

Images

 
Western Blot: HMGCL Antibody [NBP1-58026] - analysis of HMGCL in LPS+ATP treated bone marrrow derived macrophages using anti-HMGCL antibody. Image from verified customer review.
Western Blot: HMGCL Antibody [NBP1-58026] - Titration: 1.25ug/ml Positive Control: Human Liver.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HMGCL Antibody Summary

Immunogen
Synthetic peptides corresponding to HMGCL(3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase (hydroxymethylglutaricaciduria)) The peptide sequence was selected from the N terminal of HMGCL (NP_000182). Peptide sequence WVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HMGCL
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.25 ug/ml
Application Notes
This is a rabbit polyclonal antibody against HMGCL and was validated on Western blot.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 4
using
NBP1-58026 in the following application:

Publications
Read Publications using
NBP1-58026 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HMGCL Antibody

  • 3-hydroxy-3-methylglutaryl-CoA lyase
  • 3-hydroxymethyl-3-methylglutaryl-CoA lyase
  • EC 4.1.3.4
  • HLmitochondrial

Background

The deficiency of HMGCL is related to an autosomal recessive branched chain organic aciduria.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBL1-12547
Species: Hu
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-558
Species: Hu, Bv, Rb
Applications: WB, ELISA, ICC/IF, IP
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
NB600-609
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-57016
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb
Applications: WB
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-30981
Species: Hu, Mu
Applications: WB, ICC/IF
AF5535
Species: Hu
Applications: WB, Simple Western
NB400-111
Species: Hu, Mu(-)
Applications: WB, ICC/IF, IHC-Fr
NB500-395
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, IP, Flow-CS
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-26612
Species: Hu
Applications: IP (-), WB
AF2460
Species: Hu
Applications: WB, IP, Neut
NBP1-58026
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB

Publications for HMGCL Antibody (NBP1-58026)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(2)
All Species

Review for HMGCL Antibody (NBP1-58026) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-58026:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot HMGCL NBP1-58026
Enlarge
reviewed by:
Anonymous
WB Mouse 03/19/2015
View

Summary

ApplicationWestern Blot
Sample TestedBone Marrrow Derived Macrophages
SpeciesMouse

Blocking

Blocking Details5% Milk

Primary Anitbody

Dilution Ratio1:500; overnight; 4C, 2.5%Milk/TBST

Secondary Antibody

Secondary Descriptionanti-Rabbit, HRP
Secondary Concentration1:10000

Details

Detection NotesHRP, 5min, LPS untreated negative control

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HMGCL Antibody (NBP1-58026) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HMGCL Products

Bioinformatics Tool for HMGCL Antibody (NBP1-58026)

Discover related pathways, diseases and genes to HMGCL Antibody (NBP1-58026). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HMGCL Antibody (NBP1-58026)

Discover more about diseases related to HMGCL Antibody (NBP1-58026).
 

Pathways for HMGCL Antibody (NBP1-58026)

View related products by pathway.

PTMs for HMGCL Antibody (NBP1-58026)

Learn more about PTMs related to HMGCL Antibody (NBP1-58026).

Blogs on HMGCL

There are no specific blogs for HMGCL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
03/19/2015
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol HMGCL
Uniprot