HMGB2 Antibody (X1)

Images

 
Western Blot: HMGB2 Antibody (X1) [H00003148-M07] - Analysis of HMGB2 expression in Hela S3 NE (Cat # L013V3).
Immunocytochemistry/ Immunofluorescence: HMGB2 Antibody (X1) [H00003148-M07] - Analysis of monoclonal antibody to HMGB2 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: HMGB2 Antibody (X1) [H00003148-M07] - Detection limit for recombinant GST tagged HMGB2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
X1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HMGB2 Antibody (X1) Summary

Immunogen
HMGB2 (AAH00903.2, 1 a.a. - 195 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEE
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HMGB2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HMGB2 Antibody (X1)

  • High mobility group protein 2
  • high mobility group protein B2
  • high-mobility group box 2
  • HMG-2
  • HMG2high-mobility group (nonhistone chromosomal) protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF5507
Species: Hu, Mu
Applications: WB
NBP2-43666
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-74190
Species: Mu
Applications: WB, ChIP
NBP1-30888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-84754
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-34098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-41159
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-14842
Species: Hu, Po, Bv, Ca, Pm, Rb
Applications: WB
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P

Publications for HMGB2 Antibody (H00003148-M07) (0)

There are no publications for HMGB2 Antibody (H00003148-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HMGB2 Antibody (H00003148-M07) (0)

There are no reviews for HMGB2 Antibody (H00003148-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HMGB2 Antibody (H00003148-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HMGB2 Products

Bioinformatics Tool for HMGB2 Antibody (H00003148-M07)

Discover related pathways, diseases and genes to HMGB2 Antibody (H00003148-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HMGB2 Antibody (H00003148-M07)

Discover more about diseases related to HMGB2 Antibody (H00003148-M07).
 

Pathways for HMGB2 Antibody (H00003148-M07)

View related products by pathway.

PTMs for HMGB2 Antibody (H00003148-M07)

Learn more about PTMs related to HMGB2 Antibody (H00003148-M07).
 

Research Areas for HMGB2 Antibody (H00003148-M07)

Find related products by research area.

Blogs on HMGB2

There are no specific blogs for HMGB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HMGB2 Antibody (X1) and receive a gift card or discount.

Bioinformatics

Gene Symbol HMGB2