DRB1 Antibody

Product Discontinued

DRB1 Antibody Summary

• Immunogen: Synthetic peptides corresponding to DRB1 (developmentally regulated RNA-binding protein 1) The peptide sequence was selected from the N terminal of DRB1. Peptide sequence MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGD.
• Predicted Species: Mouse (100%), Rat (100%), Canine (100%), Equine (93%), Bovine (93%), Guinea Pig (100%), Rabbit (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBM45
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against DRB1 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DRB1 Antibody

• developmentally regulated RNA-binding protein 1
• Developmentally-regulated RNA-binding protein 1
• DRB1FLJ44612
• DRBP1
• MGC42237
• putative RNA binding protein RB-1
• RB-1
• RNA binding motif protein 45
• RNA-binding motif protein 45
• RNA-binding protein 45

Background

DRB1 is RNA-binding protein with binding specificity for poly(C) and may play an important role in neural development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for DRB1 Antibody (NBP1-57247). (Showing 1 - 1 of 1 FAQ).

1. I would be interested to order your rabbit anti HLA DRB1 Antibody (NBP1-57247). However, I would like to use it on mouse spleenocytes lysate with the HLA haplotype: H2b And I am a bit skeptical of how an antibody raised against a human HLA peptide can react with mouse samples, that are not supposed to share 100% homology as you claim. Therefore would it be possible to get more information about this? To what correspond the peptide used for immunization? And some examples where it has been used on mice samples with the corresponding image of the western blot please?
   • This particular immunogen region shares 100% homology with mouse. This is why it is recommended for use on mouse samples. Most commercial antibodies are generated against the human sequence and it is frequently seen that they will cross-react and when the sequence is 100% identical, the species the sequence came from is irrelevant.

Bioinformatics

• Gene Symbol: RBM45
• Uniprot:
  • Q8IUH3-3(Human)