HLA DRA Recombinant Protein Antigen

Images

 
There are currently no images for HLA DRA Protein (NBP2-38691PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HLA DRA Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HLA - DRA.

Source: E. coli

Amino Acid Sequence: AIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HLA-DRA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38691.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HLA DRA Recombinant Protein Antigen

  • FLJ51114
  • histocompatibility antigen HLA-DR alpha
  • HLA class II histocompatibility antigen, DR alpha chain
  • HLA-DRA1
  • major histocompatibility complex, class II, DR alpha
  • MHC cell surface glycoprotein
  • MHC class II antigen DRA
  • MLRW

Background

HLA-DRA is one of the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha and a beta chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. DRA does not have polymorphisms in the peptide binding part and acts as the sole alpha chain for DRB1, DRB3, DRB4 and DRB5.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84450
Species: Hu, Mu
Applications: IHC-WhMt, IHC,  IHC-P, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-45316
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-46107
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-59072
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP3-07168
Species: Pm, Ca, Pm, Hu, Pm, Sq
Applications: Flow, ICC/IF
NBP2-21584
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-52654
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP3-16006
Species: Hu
Applications: IHC,  IHC-P, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-17054
Species: Hu
Applications: IHC,  IHC-P
NBP3-35275
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF5236
Species: Mu
Applications: WB
M6000B
Species: Mu
Applications: ELISA

Publications for HLA DRA Protein (NBP2-38691PEP) (0)

There are no publications for HLA DRA Protein (NBP2-38691PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA DRA Protein (NBP2-38691PEP) (0)

There are no reviews for HLA DRA Protein (NBP2-38691PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HLA DRA Protein (NBP2-38691PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HLA DRA Products

Research Areas for HLA DRA Protein (NBP2-38691PEP)

Find related products by research area.

Blogs on HLA DRA.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HLA DRA Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-DRA