HLA DQB1 Antibody (1G6)

Images

 
Sandwich ELISA: HLA DQB1 Antibody (1G6) [H00003119-M02] - Detection limit for recombinant GST tagged HLA-DQB1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1G6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HLA DQB1 Antibody (1G6) Summary

Immunogen
HLA-DQB1 (AAH12106.1 129 a.a. - 217 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQNPII
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HLA-DQB1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HLA DQB1 Antibody (1G6)

  • DC-1 alpha chain
  • DC-alpha
  • HLA class II histocompatibility antigen, DQ alpha 1 chain-like
  • HLA-DCA
  • MHC class II DQA1

Background

HLA-DQB1 belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and it contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
H00003125-B02P
Species: Hu
Applications: WB, Flow
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-53380
Species: Hu
Applications: ICC/IF, IHC-P, PAGE
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
AF347
Species: Hu
Applications: WB, IHC, Neut
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB3428
Species: Hu
Applications: WB, IHC
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00003119-M02
Species: Hu
Applications: WB, ELISA

Publications for HLA DQB1 Antibody (H00003119-M02) (0)

There are no publications for HLA DQB1 Antibody (H00003119-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA DQB1 Antibody (H00003119-M02) (0)

There are no reviews for HLA DQB1 Antibody (H00003119-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HLA DQB1 Antibody (H00003119-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HLA DQB1 Products

Bioinformatics Tool for HLA DQB1 Antibody (H00003119-M02)

Discover related pathways, diseases and genes to HLA DQB1 Antibody (H00003119-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLA DQB1 Antibody (H00003119-M02)

Discover more about diseases related to HLA DQB1 Antibody (H00003119-M02).
 

Pathways for HLA DQB1 Antibody (H00003119-M02)

View related products by pathway.

PTMs for HLA DQB1 Antibody (H00003119-M02)

Learn more about PTMs related to HLA DQB1 Antibody (H00003119-M02).
 

Research Areas for HLA DQB1 Antibody (H00003119-M02)

Find related products by research area.

Blogs on HLA DQB1

There are no specific blogs for HLA DQB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLA DQB1 Antibody (1G6) and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-DQB1
Uniprot