HLA DOA Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HLA DOA Source: E.coli
Amino Acid Sequence: ATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEF Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
HLA-DOA |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-43684It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for HLA DOA Recombinant Protein Antigen
Background
HLA DOA, also known as HLA class II histocompatibility antigen DO alpha chain, is a 250 amino acid protein that is 28 kDa, found in lysosomes in B cells and controls HLA-DM-mediated peptide loading on MHC class II molecules. Current research is being done on several diseases and disorders including vogt-koyanagi-harada disease, alopecia universalis, alopecia, systemic lupus erythematosus, graft versus host disease, lupus erythematosus, rheumatoid arthritis, toxoplasmosis, autoimmune thyroiditis, leishmaniasis, myocarditis, diabetes mellitus, arthritis influenza, immunodeficiency, asthma, tuberculosis, thyroiditis, interferon, and hepatitis b. Interactions with the HLA DOA protein have shown to involve ENSG00000204252 and HLA-DMA proteins in immune response antigen presentation by MHC class II, G-protein signaling N-RAS regulation pathway, immune response IL-22 signaling pathway, immune response NFAT in immune response, immune response ICOS pathway in T-helper cell, phagosome, cell adhesion molecules (CAMs), antigen processing and presentation, intestinal immune network for IgA production,and type I diabetes mellitus pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Pm, Ca, Pm, Hu, Pm, Sq
Applications: Flow, ICC/IF
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Publications for HLA DOA Recombinant Protein Antigen (NBP3-43684PEP) (0)
There are no publications for HLA DOA Recombinant Protein Antigen (NBP3-43684PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HLA DOA Recombinant Protein Antigen (NBP3-43684PEP) (0)
There are no reviews for HLA DOA Recombinant Protein Antigen (NBP3-43684PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for HLA DOA Recombinant Protein Antigen (NBP3-43684PEP) (0)