Histone H1T Antibody - Azide and BSA Free Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 110-209 of mouse Histone H1T (NP_034507.2). LSKKAASGNDKGKGKKSASAKAKKMGLPRASRSPKSSKTKAVKKPKATPTKASGSGRKTKGAKGVQQRKSPAKARAANPNSGKAKMVMQKTDLRKAAGRK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
H1-6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
22 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for Histone H1T Antibody - Azide and BSA Free
Background
Histones are nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber as they play a critical role in transcription regulation, DNA repair, DNA replication, and chromosomal stability. Histone H1t is a 207 amino acid long, 22 kDA protein encoded by the gene HIST1H1T that lacks polyA tails and instead obtain palindromic termination elements. H1 histones are critical for the condensation of nucleosome chains into higher order structures. HIST1H1T is found on chromosome 5. HIST1H1T has been investigated in childhood leukemia and hemochromatosis. It is involved in granzyme-A pathway, histone modification, and PKA signaling and is known to interact with various genes such as YWHAQ, YWHAZ, ACTA2, POU5F1, and GSK3B.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for Histone H1T Antibody (NBP3-15574) (0)
There are no publications for Histone H1T Antibody (NBP3-15574).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Histone H1T Antibody (NBP3-15574) (0)
There are no reviews for Histone H1T Antibody (NBP3-15574).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Histone H1T Antibody (NBP3-15574) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Histone H1T Products
Research Areas for Histone H1T Antibody (NBP3-15574)
Find related products by research area.
|
Blogs on Histone H1T