Histone H1T Antibody

Images

 
Immunohistochemistry-Paraffin: Histone H1T Antibody [NBP2-57668] - Immunohistochemical staining of human testis shows nuclear positivity in ductus seminiferous.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Histone H1T Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SETVPAASASAGVAAMEKLPTKKRGRKPAGLISASRKVPNLSVSKLITEALSVSQERVGMS
Specificity
Specificity of human Histone H1T antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HIST1H1T
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Histone H1T Recombinant Protein Antigen (NBP2-57668PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Histone H1T Antibody

  • dJ221C16.2
  • H1 histone family, member T (testis-specific)
  • H1FTMGC163222
  • H1t
  • histone 1, H1t
  • histone cluster 1, H1t
  • histone H1t
  • Testicular H1 histone

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-75932
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-14260
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-67313
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07755
Species: Hu
NBP2-30567
Species: Hu
Applications: IHC, IHC-P
NBP2-37253
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-07996
Species: Hu
NBP1-77285
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-52487
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-20460
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NBP2-13224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008337-P01
Species: Hu
NBP2-57668
Species: Hu
Applications: IHC, IHC-P

Publications for Histone H1T Antibody (NBP2-57668) (0)

There are no publications for Histone H1T Antibody (NBP2-57668).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Histone H1T Antibody (NBP2-57668) (0)

There are no reviews for Histone H1T Antibody (NBP2-57668). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Histone H1T Antibody (NBP2-57668) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Histone H1T Antibody (NBP2-57668)

Discover related pathways, diseases and genes to Histone H1T Antibody (NBP2-57668). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Histone H1T Antibody (NBP2-57668)

Discover more about diseases related to Histone H1T Antibody (NBP2-57668).
 

Pathways for Histone H1T Antibody (NBP2-57668)

View related products by pathway.

PTMs for Histone H1T Antibody (NBP2-57668)

Learn more about PTMs related to Histone H1T Antibody (NBP2-57668).
 

Research Areas for Histone H1T Antibody (NBP2-57668)

Find related products by research area.

Blogs on Histone H1T

There are no specific blogs for Histone H1T, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Histone H1T Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HIST1H1T