Histone H1.1 Antibody

Images

 
Western Blot: Histone H1.1 Antibody [H00003024-D01P] - Analysis of HIST1H1A expression in transfected 293T cell line by HIST1H1A polyclonal antibody.Lane 1: HIST1H1A transfected lysate(21.80 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Histone H1.1 Antibody Summary

Immunogen
HIST1H1A (NP_005316.1, 1 a.a. - 215 a.a.) full-length human protein. MSETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVTKPKTAKPKKAAPKKK
Marker
Nuclear Marker
Specificity
HIST1H1A - histone cluster 1, H1a,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HIST1H1A
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Histone H1.1 Antibody

  • H1 histone family, member 1
  • H1.1
  • H1A
  • H1F1HIST1
  • histone 1, H1a
  • histone cluster 1, H1a
  • histone H1.1
  • MGC126642
  • MGC138345

Background

Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H1 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-16847
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49202
Species: Hu
Applications: IHC
NBP2-56042
Species: Hu
Applications: IHC-P
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-58095
Species: Hu
Applications: WB
NBP1-44999
Species: Hu, Mu
Applications: WB, ICC/IF
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
NBP2-14260
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-16772
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81252
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-48588
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003024-D01P
Species: Hu
Applications: WB

Publications for Histone H1.1 Antibody (H00003024-D01P) (0)

There are no publications for Histone H1.1 Antibody (H00003024-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Histone H1.1 Antibody (H00003024-D01P) (0)

There are no reviews for Histone H1.1 Antibody (H00003024-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Histone H1.1 Antibody (H00003024-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Histone H1.1 Products

Bioinformatics Tool for Histone H1.1 Antibody (H00003024-D01P)

Discover related pathways, diseases and genes to Histone H1.1 Antibody (H00003024-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Histone H1.1 Antibody (H00003024-D01P)

Discover more about diseases related to Histone H1.1 Antibody (H00003024-D01P).
 

Pathways for Histone H1.1 Antibody (H00003024-D01P)

View related products by pathway.

Research Areas for Histone H1.1 Antibody (H00003024-D01P)

Find related products by research area.

Blogs on Histone H1.1

There are no specific blogs for Histone H1.1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Histone H1.1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HIST1H1A
Entrez
Uniprot