Histamine N-Methyltransferase/HNMT Antibody

Images

 
Western Blot: Histamine N-Methyltransferase/HNMT Antibody [H00003176-D01P] - Analysis of HNMT expression in transfected 293T cell line by HNMT polyclonal antibody.Lane 1: HNMT transfected lysate(33.30 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Histamine N-Methyltransferase/HNMT Antibody Summary

Immunogen
HNMT (AAH20677.1, 1 a.a. - 292 a.a.) full-length human protein. MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGDENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
Specificity
HNMT - histamine N-methyltransferase,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HNMT
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Histamine N-Methyltransferase/HNMT Antibody

  • EC 2.1.1.8
  • Histamine NMethyltransferase
  • Histamine N-Methyltransferase
  • HMT
  • HNMT
  • HNMT-S1
  • HNMT-S2

Background

In mammals, histamine is metabolized by two major pathways: N(tau)-methylation via histamine N-methyltransferase and oxidative deamination via diamine oxidase. This gene encodes the first enzyme which is found in the cytosol and uses S-adenosyl-L-methionine as the methyl donor. In the mammalian brain, the neurotransmitter activity of histamine is controlled by N(tau)-methylation as diamine oxidase is not found in the central nervous system. A common genetic polymorphism affects the activity levels of this gene product in red blood cells. Multiple alternatively spliced transcript variants that encode different proteins have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58006
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84304
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16800
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-00688
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89165
Species: Hu
Applications: IHC, IHC-P
NBP2-43801
Species: Hu
Applications: WB
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
PP-A8620A-00
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
MAB4726
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-59580
Species: Hu, Rt
Applications: WB
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-52559
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
H00003176-D01P
Species: Hu
Applications: WB

Publications for Histamine N-Methyltransferase/HNMT Antibody (H00003176-D01P) (0)

There are no publications for Histamine N-Methyltransferase/HNMT Antibody (H00003176-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Histamine N-Methyltransferase/HNMT Antibody (H00003176-D01P) (0)

There are no reviews for Histamine N-Methyltransferase/HNMT Antibody (H00003176-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Histamine N-Methyltransferase/HNMT Antibody (H00003176-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Histamine N-Methyltransferase/HNMT Products

Bioinformatics Tool for Histamine N-Methyltransferase/HNMT Antibody (H00003176-D01P)

Discover related pathways, diseases and genes to Histamine N-Methyltransferase/HNMT Antibody (H00003176-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Histamine N-Methyltransferase/HNMT Antibody (H00003176-D01P)

Discover more about diseases related to Histamine N-Methyltransferase/HNMT Antibody (H00003176-D01P).
 

Pathways for Histamine N-Methyltransferase/HNMT Antibody (H00003176-D01P)

View related products by pathway.

PTMs for Histamine N-Methyltransferase/HNMT Antibody (H00003176-D01P)

Learn more about PTMs related to Histamine N-Methyltransferase/HNMT Antibody (H00003176-D01P).

Blogs on Histamine N-Methyltransferase/HNMT

There are no specific blogs for Histamine N-Methyltransferase/HNMT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Histamine N-Methyltransferase/HNMT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HNMT
Entrez
Uniprot