Recombinant Human Hippocalcin Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Hippocalcin Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 193 of Human HPCA full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSPGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSRSQF

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
HPCA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
46.86 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Hippocalcin Protein

  • BDR2
  • Calcium-binding protein BDR-2
  • hippocalcin
  • neuron specific calcium-binding protein hippocalcin
  • neuron-specific calcium-binding protein hippocalcin

Background

The protein encoded by this gene is a member of neuron-specific calcium-binding proteins family found in the retina and brain. This protein is associated with the plasma membrane. It has similarities to proteins located in the photoreceptor cells that regulate photosignal transduction in a calcium-sensitive manner. This protein displays recoverin activity and a calcium-dependent inhibition of rhodopsin kinase. It is identical to the rat and mouse hippocalcin proteins and thought to play an important role in neurons of the central nervous system in a number of species. HPCA( NP_002134, 1 a.a. - 194 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005957-M37
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NB120-2776
Species: Hu, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP1-37003
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-47935
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85016
Species: Hu
Applications: WB, IHC, IHC-P
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IF
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
NBP2-25169
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-66296
Species: Hu
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-50028
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
MAB829
Species: Hu
Applications: WB, IHC
H00003208-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Hippocalcin Recombinant Protein (H00003208-P01) (0)

There are no publications for Hippocalcin Recombinant Protein (H00003208-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hippocalcin Recombinant Protein (H00003208-P01) (0)

There are no reviews for Hippocalcin Recombinant Protein (H00003208-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hippocalcin Recombinant Protein (H00003208-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Hippocalcin Recombinant Protein (H00003208-P01)

Discover related pathways, diseases and genes to Hippocalcin Recombinant Protein (H00003208-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hippocalcin Recombinant Protein (H00003208-P01)

Discover more about diseases related to Hippocalcin Recombinant Protein (H00003208-P01).
 

Pathways for Hippocalcin Recombinant Protein (H00003208-P01)

View related products by pathway.

PTMs for Hippocalcin Recombinant Protein (H00003208-P01)

Learn more about PTMs related to Hippocalcin Recombinant Protein (H00003208-P01).

Blogs on Hippocalcin

There are no specific blogs for Hippocalcin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Hippocalcin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HPCA