hHpr1-p84-Thoc1 Antibody (6E3A7) Summary
| Description |
Novus Biologicals Rabbit hHpr1-p84-Thoc1 Antibody (6E3A7) (NBP3-16800) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 350-450 of human hHpr1-p84-Thoc1 (NP_005122.2). SLWIEDTTKSVYQLLSENPPDGERFSKMVEHILNTEENWNSWKNEGCPSFVKERTSDTKPTRIIRKRTAPEDFLGKGPTKKILMGNEELTRLWNLCPDNME |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
THOC1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for hHpr1-p84-Thoc1 Antibody (6E3A7)
Background
P84/N5-5E10 recognizes an 84kDa nuclear matrix protein. Initially isolated by its interaction with the amino terminal region of the retinoblastoma protein, it has been used extensively as a nuclear-specific marker in both immunofluorescence and cell fractionation studies.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, QFN
Species: Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, Neut, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: IP, KO, WB
Species: Hu, Mu, Rt
Applications: WB
Publications for hHpr1-p84-Thoc1 Antibody (NBP3-16800) (0)
There are no publications for hHpr1-p84-Thoc1 Antibody (NBP3-16800).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for hHpr1-p84-Thoc1 Antibody (NBP3-16800) (0)
There are no reviews for hHpr1-p84-Thoc1 Antibody (NBP3-16800).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for hHpr1-p84-Thoc1 Antibody (NBP3-16800) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional hHpr1-p84-Thoc1 Products
Research Areas for hHpr1-p84-Thoc1 Antibody (NBP3-16800)
Find related products by research area.
|
Blogs on hHpr1-p84-Thoc1