HFE Recombinant Protein Antigen

Images

 
There are currently no images for HFE Protein (NBP2-38702PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HFE Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HFE.

Source: E.coli

Amino Acid Sequence: LGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWE

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HFE
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38702.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for HFE Recombinant Protein Antigen

  • dJ221C16.10.1
  • hemochromatosis
  • hereditary hemochromatosis protein HLA-H
  • hereditary hemochromatosis protein
  • HFE
  • HFE1
  • HH
  • high Fe
  • HLAH
  • HLA-H
  • HLA-HHFE1
  • MGC103790
  • MHC class I-like protein HFE
  • MVCD7
  • TFQTL2

Background

HFE is encoded by this gene is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in this gene. At least nine alternatively spliced variants have been described for this gene. Additional variants have been found but their full-length nature has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

2914-HT
Species: Hu
Applications: BA
1845-SH/CF
Species: Hu
Applications: BA
NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, KD, WB
DHP250
Species: Hu
Applications: ELISA
NBP1-47945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-06699
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP3-04509
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-06699
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
MAB3120
Species: Hu
Applications: Simple Western, WB
AF3634
Species: Mu
Applications: WB
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1705
Species: Mu
Applications: IHC, WB
AF482
Species: Mu
Applications: IHC, WB
AF3635
Species: Mu
Applications: IHC, WB
NBP1-85351
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-33581
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NBP1-47791
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB

Publications for HFE Protein (NBP2-38702PEP) (0)

There are no publications for HFE Protein (NBP2-38702PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HFE Protein (NBP2-38702PEP) (0)

There are no reviews for HFE Protein (NBP2-38702PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HFE Protein (NBP2-38702PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HFE Products

Array NBP2-38702PEP

Bioinformatics Tool for HFE Protein (NBP2-38702PEP)

Discover related pathways, diseases and genes to HFE Protein (NBP2-38702PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HFE Protein (NBP2-38702PEP)

Discover more about diseases related to HFE Protein (NBP2-38702PEP).
 

Pathways for HFE Protein (NBP2-38702PEP)

View related products by pathway.

PTMs for HFE Protein (NBP2-38702PEP)

Learn more about PTMs related to HFE Protein (NBP2-38702PEP).
 

Research Areas for HFE Protein (NBP2-38702PEP)

Find related products by research area.

Blogs on HFE.

The role of Smoothened in pulmonary pathologies
The Hedgehog (Hh) family of secreted proteins is involved in a number of developmental processes, one of which is the development of cancer. Past data suggests that the Sonic hedgehog (Shh) receptor is composed of two transmembrane proteins, Patche...  Read full blog post.

Customers Who Bought This Also Bought

HFE Antibody (1G12)
H00003077-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HFE Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HFE