HFE Recombinant Protein Antigen

Images

 
There are currently no images for HFE Protein (NBP1-83250PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HFE Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HFE.

Source: E. coli

Amino Acid Sequence: YLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPSPS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HFE
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83250.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HFE Recombinant Protein Antigen

  • dJ221C16.10.1
  • hemochromatosis
  • hereditary hemochromatosis protein HLA-H
  • hereditary hemochromatosis protein
  • HFE
  • HFE1
  • HH
  • high Fe
  • HLAH
  • HLA-H
  • HLA-HHFE1
  • MGC103790
  • MHC class I-like protein HFE
  • MVCD7
  • TFQTL2

Background

HFE is encoded by this gene is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in this gene. At least nine alternatively spliced variants have been described for this gene. Additional variants have been found but their full-length nature has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

2914-HT
Species: Hu
Applications: BA
NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC,  IHC-P, KD, WB
DHP250
Species: Hu
Applications: ELISA
MAB41051
Species: Hu, Mu
Applications: WB
NLS2666
Species: Bt, Bv, Ca, Eq, Ha, Hu, Pm, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P
NBP3-04509
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
MAB3120
Species: Hu
Applications: Simple Western, WB
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1705
Species: Mu
Applications: IHC, WB
AF482
Species: Mu
Applications: IHC, WB
AF3635
Species: Mu
Applications: IHC, WB
NBP1-85351
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-33581
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-33711
Species: Hu
Applications: IHC,  IHC-P
NBP1-47791
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB

Publications for HFE Protein (NBP1-83250PEP) (0)

There are no publications for HFE Protein (NBP1-83250PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HFE Protein (NBP1-83250PEP) (0)

There are no reviews for HFE Protein (NBP1-83250PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HFE Protein (NBP1-83250PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HFE Products

Array NBP1-83250PEP

Research Areas for HFE Protein (NBP1-83250PEP)

Find related products by research area.

Blogs on HFE.

The role of Smoothened in pulmonary pathologies
The Hedgehog (Hh) family of secreted proteins is involved in a number of developmental processes, one of which is the development of cancer. Past data suggests that the Sonic hedgehog (Shh) receptor is composed of two transmembrane proteins, Patche...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HFE Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HFE