Recombinant Human HES-1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HES-1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 36 - 142 of Human HES1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
HES1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HES-1 Protein

  • BHLHB39
  • bHLHb39hairy homolog (Drosophila)
  • Class B basic helix-loop-helix protein 39
  • FLJ20408
  • Hairy and enhancer of split 1
  • hairy and enhancer of split 1, (Drosophila)
  • Hairy homolog
  • Hairy-like protein
  • HES1
  • HES-1
  • hHL
  • HL
  • HRY
  • HRYHHL
  • transcription factor HES-1

Background

HES1 - hairy and enhancer of split 1, (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBL1-12547
Species: Hu
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4079
Species: Hu
Applications: WB, ICC
NB300-558
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IP
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-41305
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-57016
Species: Hu
Applications: WB
AF2567
Species: Mu
Applications: WB, IHC
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-30981
Species: Hu, Mu
Applications: WB, ICC/IF
AF5535
Species: Hu
Applications: WB, Simple Western
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for HES-1 Partial Recombinant Protein (H00003280-Q01) (0)

There are no publications for HES-1 Partial Recombinant Protein (H00003280-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HES-1 Partial Recombinant Protein (H00003280-Q01) (0)

There are no reviews for HES-1 Partial Recombinant Protein (H00003280-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HES-1 Partial Recombinant Protein (H00003280-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HES-1 Products

Bioinformatics Tool for HES-1 Partial Recombinant Protein (H00003280-Q01)

Discover related pathways, diseases and genes to HES-1 Partial Recombinant Protein (H00003280-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HES-1 Partial Recombinant Protein (H00003280-Q01)

Discover more about diseases related to HES-1 Partial Recombinant Protein (H00003280-Q01).
 

Pathways for HES-1 Partial Recombinant Protein (H00003280-Q01)

View related products by pathway.

PTMs for HES-1 Partial Recombinant Protein (H00003280-Q01)

Learn more about PTMs related to HES-1 Partial Recombinant Protein (H00003280-Q01).
 

Research Areas for HES-1 Partial Recombinant Protein (H00003280-Q01)

Find related products by research area.

Blogs on HES-1

There are no specific blogs for HES-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HES-1 Partial Protein
H00003280-Q03-10ug

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HES-1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HES1
Entrez