We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

HERC4 Recombinant Protein Antigen

Images

 
There are currently no images for HERC4 Recombinant Protein Antigen (NBP2-56037PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HERC4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HERC4.

Source: E. coli

Amino Acid Sequence: GNASFGQLGLGGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSRKKPEQV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HERC4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56037.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HERC4 Recombinant Protein Antigen

  • DKFZP564G092
  • EC 6.3.2
  • EC 6.3.2.-
  • HECT domain and RCC1-like domain-containing protein 4
  • hect domain and RLD 4
  • KIAA1593probable E3 ubiquitin-protein ligase HERC4

Background

HERC4 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1 (MIM 179710)-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins (Hochrainer et al., 2005 [PubMed 15676274]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03971
Species: Bv, Ca, Ch, ChHa, Eq, Hu, Mu, Po, Pm, Rb, Rt
Applications: IHC,  IHC-P, WB
NBP1-85348
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-51641
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, WB
NBP1-76879
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-49505
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF7034
Species: Hu
Applications: WB
H00057169-B01P
Species: Hu
Applications: ICC/IF, WB
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
NBP2-21037
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-00348
Species: Hu
Applications: ELISA, IHC,  IHC-P, IP, WB
AF8014
Species: Hu
Applications: IHC
NBP1-55025
Species: Hu
Applications: WB
NBP1-57718
Species: Hu
Applications: WB
UL-553
Species: Hu
Applications: EnzAct
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP3-16540
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC,  IHC-P

Publications for HERC4 Recombinant Protein Antigen (NBP2-56037PEP) (0)

There are no publications for HERC4 Recombinant Protein Antigen (NBP2-56037PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HERC4 Recombinant Protein Antigen (NBP2-56037PEP) (0)

There are no reviews for HERC4 Recombinant Protein Antigen (NBP2-56037PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HERC4 Recombinant Protein Antigen (NBP2-56037PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HERC4 Products

Array NBP2-56037PEP

Research Areas for HERC4 Recombinant Protein Antigen (NBP2-56037PEP)

Find related products by research area.

Blogs on HERC4

There are no specific blogs for HERC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HERC4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HERC4