HERC4 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HERC4. Source: E.coli Amino Acid Sequence: GNASFGQLGLGGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSRKKPEQV |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
HERC4 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This peptide is useful as a blocking peptide for NBP2-56037 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here. |
| Theoretical MW |
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Alternate Names for HERC4 Recombinant Protein Antigen
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, ChHa, Eq, Pm, Rb
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC, IHC-FrFl
Species: Ce
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, In vitro, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu
Applications: IHC
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: AC
Publications for HERC4 Recombinant Protein Antigen (NBP2-56037PEP) (0)
There are no publications for HERC4 Recombinant Protein Antigen (NBP2-56037PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HERC4 Recombinant Protein Antigen (NBP2-56037PEP) (0)
There are no reviews for HERC4 Recombinant Protein Antigen (NBP2-56037PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for HERC4 Recombinant Protein Antigen (NBP2-56037PEP) (0)
Other Available Formats
Additional HERC4 Products
Bioinformatics Tool for HERC4 Recombinant Protein Antigen (NBP2-56037PEP)
Discover related pathways, diseases and genes to HERC4 Recombinant Protein Antigen (NBP2-56037PEP). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for HERC4 Recombinant Protein Antigen (NBP2-56037PEP)
Discover more about diseases related to HERC4 Recombinant Protein Antigen (NBP2-56037PEP).
| | Pathways for HERC4 Recombinant Protein Antigen (NBP2-56037PEP)
View related products by pathway.
|
PTMs for HERC4 Recombinant Protein Antigen (NBP2-56037PEP)
Learn more about PTMs related to HERC4 Recombinant Protein Antigen (NBP2-56037PEP).
|
Blogs on HERC4
![Western Blot: Viperin Antibody [NBP2-03971] - Analysis of viperin using viperin polyclonal antibody. Human brain lysate in the absence (1) and presence (2) of immunizing peptide, mouse brain (3) and rat brain (4) lysate probed with viperin antibody at 3 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.](http://images.novusbio.com/images2/Viperin-Antibody-Western-Blot-NBP2-03971-img0003.jpg)
![Immunohistochemistry-Paraffin: Viperin Antibody [NBP2-03971] - Analysis of viperin using viperin polyclonal antibody. Human rectum tissue probed with viperin antibody at 5 ug/ml.](http://images.novusbio.com/images2/Viperin-Antibody-Immunohistochemistry-Paraffin-NBP2-03971-img0004.jpg)
![Western Blot: DHX58 Antibody [NBP1-85348] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-163](http://images.novusbio.com/images2/DHX58-Antibody-Western-Blot-NBP1-85348-img0005.jpg)
![Immunohistochemistry-Paraffin: DHX58 Antibody [NBP1-85348] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/images2/DHX58-Antibody-Immunohistochemistry-Paraffin-NBP1-85348-img0007.jpg)
![Western Blot: Sirtuin 1/SIRT1 Antibody (1F3) [NBP1-51641] - Western blot analysis using SIRT1 mouse mAb against MCF-7 (1), Jurkat (2), Hela (3), HEK293 (4) and A549 (5) cell lysates.](http://images.novusbio.com/images2/Sirtuin-1-SIRT1-Antibody-(1F3)-Western-Blot-NBP1-51641-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: Sirtuin 1/SIRT1 Antibody (1F3) [NBP1-51641] - SIRT1 antibody was tested at 1:10 in Ntera2 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Image objective 40x.](http://images.novusbio.com/images2/Sirtuin-1-SIRT1-Antibody-(1F3)-Immunocytochemistry-Immunofluorescence-NBP1-51641-img0012.jpg)
![Immunohistochemistry-Paraffin: Sirtuin 1/SIRT1 Antibody (1F3) [NBP1-51641] - Immunohistochemical analysis of paraffin-embedded lung cancer tissues (left) and kidney cancer tissues (right) using SIRT1 mouse mAb with DAB staining.](http://images.novusbio.com/images2/Sirtuin-1-SIRT1-Antibody-(1F3)-Immunohistochemistry-Paraffin-NBP1-51641-img0003.jpg)
![Western Blot: Sir2.1 Antibody [NB100-1923] - Western blot using NB100-1923 against His tagged SIR-2.1 full-length protein.](http://images.novusbio.com/images2/Sir2.1 Antibody-Western Blot-NB100-1923-img0003.jpg)
![Western Blot: Importin 11 Antibody [NB100-56484] - Analysis of Importin-11 in HeLa lysate in the 1) absence and 2) presence of immunizing peptide using this antibody at 1 ug/ml.](http://images.novusbio.com/images2/Importin 11 Antibody-Western Blot-NB100-56484-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: ZNFX1 Antibody [NBP2-13602] - Immunofluorescent staining of human cell line PC-3 shows localization to mitochondria.](http://images.novusbio.com/images2/ZNFX1 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13602-img0003.jpg)
![Immunohistochemistry-Paraffin: ZNFX1 Antibody [NBP2-13602] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/ZNFX1-Antibody-Immunohistochemistry-Paraffin-NBP2-13602-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: CD19 Antibody (CB19) [NBP2-25196] - The CD19 (CB19) antibody was tested in Daudi cells at a 1:40 dilution against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 568 (Red) and DAPI (Blue), respectively.](http://images.novusbio.com/images2/CD19-Antibody-(CB19)-Immunocytochemistry-Immunofluorescence-NBP2-25196-img0002.jpg)
![Flow Cytometry: CD19 Antibody (CB19) [NBP2-25196] - A surface stain was performed on Ramos cells with CD19 Antibody (CB19) NBP2-26646 (blue) and a matched isotype control (orange). Cells were incubated in an antibody dilution of 2.5 ug/mL for 20 minutes at room temperature. Both antibodies were conjugated to phycoerythrin.](http://images.novusbio.com/images2/CD19-Antibody-(CB19)-Flow-Cytometry-NBP2-25196-img0013.jpg)
![Flow Cytometry: CD19 Antibody (CB19) [NBP2-25196] - Surface staining of 10^6 human lymphocytes using 0.2 ug of CD19 antibody (red) and isotype control (green). Cell surface staining kit was used for this test.](http://images.novusbio.com/images2/CD19-Antibody-(CB19)-Flow-Cytometry-NBP2-25196-img0001.jpg)
![Western Blot: ZNF645 Antibody [NBP2-21037] - Sample (30 ug of whole cell lysate) A: MCF-7 10% SDS PAGE gel, diluted at 1:500.](http://images.novusbio.com/images2/ZNF645 Antibody-Western Blot-NBP2-21037-img0001.jpg)
![Immunohistochemistry-Paraffin: ZNF645 Antibody [NBP2-21037] - Immunohistochemical analysis of paraffin-embedded GASTRIC CA, using antibody at 1:500 dilution.](http://images.novusbio.com/images2/ZNF645 Antibody-Immunohistochemistry-Paraffin-NBP2-21037-img0002.jpg)
![Western Blot: MRTO4 Antibody [NBP3-00348] - Anti-MRTO4 rabbit polyclonal antibody at 1:500 dilution. Lane A: HepG2 Whole Cell Lysate. Lane B: Jurkat Whole Cell Lysate. Lysates/proteins at 30 ug per lane. Secondary Goat Anti-Rabbit IgG H&L (Dylight 800) at 1/10000 dilution. Developed using the Odyssey technique. Performed under reducing conditions. Predicted band size: 28 kDa. Observed band size: 28 kDa (We are unsure as to the identity of these extra bands).](http://images.novusbio.com/images2/MRTO4-Antibody-Western-Blot-NBP3-00348-img0002.jpg)
![Immunohistochemistry-Paraffin: MRTO4 Antibody [NBP3-00348] - Immunochemical staining of human MRTO4 in human placenta with rabbit polyclonal antibody (1:1000, formalin-fixed paraffin embedded sections).](http://images.novusbio.com/images2/MRTO4-Antibody-Immunohistochemistry-Paraffin-NBP3-00348-img0004.jpg)
![Immunohistochemistry-Paraffin: MRTO4 Antibody [NBP3-00348] - Immunochemical staining of human MRTO4 in human liver with rabbit polyclonal antibody (1:1000, formalin-fixed paraffin embedded sections).](http://images.novusbio.com/images2/MRTO4-Antibody-Immunohistochemistry-Paraffin-NBP3-00348-img0003.jpg)
![Western Blot: HERC6 Antibody [NBP1-55025] - Titration: 0.2-1 ug/ml Positive Control: ACHN cell lysate.](http://images.novusbio.com/images2/HERC6-Antibody-Western-Blot-NBP1-55025-img0003.jpg)
![Western Blot: HERC6 Antibody [NBP1-55025] - hek293 cell lysate at 1:1000.](http://images.novusbio.com/images2/HERC6-Antibody-Western-Blot-NBP1-55025-img0002.jpg)
![Western Blot: DNAJC12 Antibody [NBP1-57718] - THP-1 cell lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/images2/DNAJC12 Antibody-Western Blot-NBP1-57718-img0002.jpg)
![Western Blot: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - Analysis of p50 in HeLa lysate in the A) absence and B) presence of immunizing peptide using p50 antibody at 5 ug/ml.](http://images.novusbio.com/images2/NFkB-p105-p50-Antibody-(2J10D7)-Western-Blot-NB100-56583-img0004.jpg)
![Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - IHC-P of rabbit aorta using NB100-56583. Secondary antibody: anti-mouse histofine ( Nisherei Bioscience Inc. ref: 414131F). Development: DAB (Dako ref: K346811-2) and counterstained with Hematoxylin. Submitted via verified customer review](http://images.novusbio.com/images2/NFkB-p105-p50-Antibody-(2J10D7)-Immunohistochemistry-Paraffin-NB100-56583-img0009.jpg)
![Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on U937 cells with NFkB p105/p50 [2J10D7] Antibody NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 650.](http://images.novusbio.com/images2/NFkB-p105-p50-Antibody-(2J10D7)-Flow-Cytometry-NB100-56583-img0008.jpg)
![Western Blot: SUMO2/3 Antibody (SM23/496) - Azide and BSA Free [NBP2-34717] - analysis of SUMO-2 in human HeLa Cell lysate](http://images.novusbio.com/images2/SUMO2-3-Antibody-(SM23-496)---Azide-and-BSA-Free-Western-Blot-NBP2-34717-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: SUMO2/3 Antibody (SM23/496) - Azide and BSA Free [NBP2-34717] - Immunofluorescence staining of paraformaldehyde-fixed MCF-7 cells with SUMO2/3 Antibody (SM23/496) followed by goat anti-Mouse IgG-CF488 (Green). Membrane are labeled with Phalloidin (Red).](http://images.novusbio.com/images2/SUMO2-3-Antibody-(SM23-496)---Azide-and-BSA-Free-Immunocytochemistry-Immunofluorescence-NBP2-34717-img0006.jpg)
![Immunohistochemistry-Paraffin: SUMO2/3 Antibody (SM23/496) - Azide and BSA Free [NBP2-34717] - Formalin-paraffin human Breast Ca](http://images.novusbio.com/images2/SUMO2-3-Antibody-(SM23-496)---Azide-and-BSA-Free-Immunohistochemistry-Paraffin-NBP2-34717-img0001.jpg)
![Western Blot: MUL1 Antibody (5H6.2D5) [NBP2-31361] - WB detection of partial recombinant protein MUL1 by using MUL1 antibody (clone 5H6.2D5) at a concentration of 0.01 ug/ml.](http://images.novusbio.com/images2/MUL1-Antibody-(5H6.2D5)-Western-Blot-NBP2-31361-img0001.jpg)
![Immunohistochemistry-Paraffin: MUL1 Antibody (5H6.2D5) [NBP2-31361] - IHC-P analysis of MUL1 protein in a transverse section of normal skeletal muscle from human using 5 ug/ml concentration of MUL1 antibody (clone 5H6.2D5). The myocytes and blood capillaries depicted strong staining whereas the nuclei were found negative for MUL1.](http://images.novusbio.com/images2/MUL1-Antibody-(5H6.2D5)-Immunohistochemistry-Paraffin-NBP2-31361-img0005.jpg)
![Immunohistochemistry-Paraffin: MUL1 Antibody (5H6.2D5) [NBP2-31361] - IHC-P analysis of MUL1 protein in a section of normal prostate from human using 5 ug/ml concentration of MUL1 antibody (clone 5H6.2D5). Strong cytoplasmic staining was observed in the epithelial columnar and basal cells of prostate glands.](http://images.novusbio.com/images2/MUL1-Antibody-(5H6.2D5)-Immunohistochemistry-Paraffin-NBP2-31361-img0006.jpg)
![Immunohistochemistry-Paraffin: TRIM50 Antibody [NBP1-81988] - Staining of human bone marrow shows strong cytoplasmic positivity in a subset of bone marrow poietic cells.](http://images.novusbio.com/images2/TRIM50-Antibody-Immunohistochemistry-Paraffin-NBP1-81988-img0005.jpg)