HEMK2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HEMK2 Antibody [NBP2-57126] - Staining of human cell line A-431 shows localization to nucleoplasm & centrosome. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HEMK2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFT
Specificity
Specificity of human HEMK2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
N6AMT1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HEMK2 Recombinant Protein Antigen (NBP2-57126PEP)

Reactivity Notes

Mouse 85%, Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for HEMK2 Antibody

  • C21orf127
  • chromosome 21 open reading frame 127
  • EC 2.1.1.-
  • HemK methyltransferase family member 2
  • HEMK2
  • m.HsaHemK2P
  • MGC19995
  • MTQ2
  • N(6)-adenine-specific DNA methyltransferase 1
  • N-6 adenine-specific DNA methyltransferase 1 (putative)
  • N6AMT
  • N6-DNA-methyltransferase
  • PRED28

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31113
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-86906
Species: Hu
Applications: WB, IHC, IHC-P
AF5059
Species: Hu
Applications: WB, IHC
NB100-1131
Species: Hu, ArHa
Applications: WB, IHC, IHC-P, PEP-ELISA
H00009617-B01P
Species: Hu
Applications: WB
NB100-56519
Species: Hu, Mu, Rt, Po, Bv, Sh
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC, IHC-FrFl, KD
NB100-64959
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr
NBP2-43745
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr
NBP1-81019
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59777
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-88402
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-56618
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-CS
NBP1-92009
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-57126
Species: Hu
Applications: ICC/IF

Publications for HEMK2 Antibody (NBP2-57126) (0)

There are no publications for HEMK2 Antibody (NBP2-57126).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HEMK2 Antibody (NBP2-57126) (0)

There are no reviews for HEMK2 Antibody (NBP2-57126). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HEMK2 Antibody (NBP2-57126) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HEMK2 Products

Bioinformatics Tool for HEMK2 Antibody (NBP2-57126)

Discover related pathways, diseases and genes to HEMK2 Antibody (NBP2-57126). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for HEMK2 Antibody (NBP2-57126)

View related products by pathway.

PTMs for HEMK2 Antibody (NBP2-57126)

Learn more about PTMs related to HEMK2 Antibody (NBP2-57126).

Blogs on HEMK2

There are no specific blogs for HEMK2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HEMK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol N6AMT1