HECTD3 Antibody

Images

 
Immunohistochemistry: HECTD3 Antibody [NBP1-82153] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HECTD3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VVDLTYSHRLGSRPQPAEAYAEAVQRLLYVPPTWTYECDEDLIHFLYDHLGKEDENLGSVKQYVESIDVSSYTEEFNVSCLTDSNADTY
Specificity
Specificity of human HECTD3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HECTD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HECTD3 Protein (NBP1-82153PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HECTD3 Antibody

  • E3 ubiquitin-protein ligase HECTD3
  • EC 6.3.2.-
  • FLJ21156
  • FLJ31983
  • HECT domain containing 3
  • HECT domain-containing protein 3
  • MGC161630
  • probable E3 ubiquitin-protein ligase HECTD3
  • RP11-69J16.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74502
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-90589
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB110-68281
Species: Hu, Mu, Rt, Mk
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89180
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP2-56137
Species: Hu
Applications: ICC/IF
NBP2-61889
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-30521
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
AF5448
Species: Hu, Mu, Rt
Applications: WB, IHC
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NB500-240
Species: Hu, Mu
Applications: WB, IP
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82153
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for HECTD3 Antibody (NBP1-82153) (0)

There are no publications for HECTD3 Antibody (NBP1-82153).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HECTD3 Antibody (NBP1-82153) (0)

There are no reviews for HECTD3 Antibody (NBP1-82153). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HECTD3 Antibody (NBP1-82153) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for HECTD3 Antibody (NBP1-82153)

Discover related pathways, diseases and genes to HECTD3 Antibody (NBP1-82153). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HECTD3 Antibody (NBP1-82153)

Discover more about diseases related to HECTD3 Antibody (NBP1-82153).
 

Pathways for HECTD3 Antibody (NBP1-82153)

View related products by pathway.

PTMs for HECTD3 Antibody (NBP1-82153)

Learn more about PTMs related to HECTD3 Antibody (NBP1-82153).

Blogs on HECTD3

There are no specific blogs for HECTD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HECTD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HECTD3