SLC25A45 Antibody

Images

 
Western Blot: SLC25A45 Antibody [NBP2-30521] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunocytochemistry/ Immunofluorescence: SLC25A45 Antibody [NBP2-30521] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: SLC25A45 Antibody [NBP2-30521] - Staining of human cerebellum shows moderate cytoplasmic and nuclear positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC25A45 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FDLIKVRLQNQTEPRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDTPTVGIYFITYEGLCRQYTPEGQN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A45
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC25A45 Protein (NBP2-30521PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC25A45 Antibody

  • solute carrier family 25 member 45
  • solute carrier family 25, member 45

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56137
Species: Hu
Applications: ICC/IF
NBP1-59607
Species: Hu
Applications: WB
NBP1-93525
Species: Hu
Applications: IHC, IHC-P
NBP1-93778
Species: Hu
Applications: IHC, IHC-P
NBP2-13324
Species: Hu
Applications: ICC/IF, IHC-P
NBP2-13323
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-59600
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82153
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13325
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59566
Species: Hu
Applications: WB
NBP1-59559
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86310
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30976
Species: Hu
Applications: IHC, IHC-P
NBP1-80527
Species: Hu
Applications: WB
NBP2-58085
Species: Hu
Applications: WB, ICC/IF
NBP2-30521
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SLC25A45 Antibody (NBP2-30521) (0)

There are no publications for SLC25A45 Antibody (NBP2-30521).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A45 Antibody (NBP2-30521) (0)

There are no reviews for SLC25A45 Antibody (NBP2-30521). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SLC25A45 Antibody (NBP2-30521) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC25A45 Products

Bioinformatics Tool for SLC25A45 Antibody (NBP2-30521)

Discover related pathways, diseases and genes to SLC25A45 Antibody (NBP2-30521). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A45 Antibody (NBP2-30521)

Discover more about diseases related to SLC25A45 Antibody (NBP2-30521).
 

Pathways for SLC25A45 Antibody (NBP2-30521)

View related products by pathway.

Blogs on SLC25A45

There are no specific blogs for SLC25A45, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC25A45 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A45
Uniprot