Recombinant Human HE4/WFDC2 Protein

Images

 
SDS-Page: HE4/WFDC2 Recombinant Protein [H00010406-P01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HE4/WFDC2 Protein Summary

Description
HE4/WFDC2 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
WFDC2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publications using H00010406-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HE4/WFDC2 Protein

  • dJ461P17.6
  • EDDM4
  • Epididymal secretory protein E4
  • epididymis-specific, whey-acidic protein type, four-disulfide core
  • HE4
  • HE4MGC57529
  • Major epididymis-specific protein E4
  • Putative protease inhibitor WAP5
  • WAP domain containing protein HE4-V4
  • WAP four-disulfide core domain 2
  • WAP four-disulfide core domain protein 2
  • WAP5
  • WAP5epididymal protein 4
  • WFDC2

Background

WFDC2( AAH46106, 31 a.a. - 125 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA
NB110-85538
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00009354-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-60046
Species: Hu, Mu, Rt, Po, Bv, Eq, Gt, GP, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84943
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84012
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-52645
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, CyTOF-ready
MAB4620
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
AF1747
Species: Hu
Applications: WB, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF1095
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00010406-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for HE4/WFDC2 Recombinant Protein (H00010406-P01)(2)

Reviews for HE4/WFDC2 Recombinant Protein (H00010406-P01) (0)

There are no reviews for HE4/WFDC2 Recombinant Protein (H00010406-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HE4/WFDC2 Recombinant Protein (H00010406-P01). (Showing 1 - 2 of 2 FAQs).

  1. I would like to build a sandwich ELISA for detection of HE4 levels in human blood. I found there are several HE4 antibodies from your company. Could you please provide me some information among these products, which two antibodies will work well with the HE4 antigen in a sandwich ELISA pair?
    • At this time we have not tested any of our HE4 antibodies for use in a Sandwich ELISA. As such, we cannot say with certainty, which will work together as an effective pair. Often times in our experience, choosing a monoclonal antibody for capture, and a polyclonal antibody for detection will yield great results. If you plan on testing any of our HE4 antibodies for use in a Sandwich ELISA then we would encourage you to apply for our Innovators Reward Program. Under the terms of this program, you will be eligible for a full credit in exchange for your data, in the form of an online review, regardless of positive or negative results. Additional Innovator’s Reward information can be found at the following link: www.novusbio.com/support/innovators-reward.html
  2. We will want to use this full-length protein, but we will also want to use the protein with the GST tag removed. How can we remove the tag from this sequence?
    • This is a product we distribute for a Taiwanese company called Abnova. Here is a link, provided by Abnova, to the protocol for removing the GST tag from the full length protein.

Additional HE4/WFDC2 Products

Bioinformatics Tool for HE4/WFDC2 Recombinant Protein (H00010406-P01)

Discover related pathways, diseases and genes to HE4/WFDC2 Recombinant Protein (H00010406-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HE4/WFDC2 Recombinant Protein (H00010406-P01)

Discover more about diseases related to HE4/WFDC2 Recombinant Protein (H00010406-P01).
 

Pathways for HE4/WFDC2 Recombinant Protein (H00010406-P01)

View related products by pathway.

PTMs for HE4/WFDC2 Recombinant Protein (H00010406-P01)

Learn more about PTMs related to HE4/WFDC2 Recombinant Protein (H00010406-P01).
 

Research Areas for HE4/WFDC2 Recombinant Protein (H00010406-P01)

Find related products by research area.

Blogs on HE4/WFDC2

There are no specific blogs for HE4/WFDC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MUC-1 Antibody
NBP1-60046
MUC-1 Antibody
NBP1-60046
MUC-1 Antibody
NBP1-60046

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HE4/WFDC2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol WFDC2
Entrez