HDC2/PHC2 Antibody (1F4)

Images

 
Western Blot: HDC2/PHC2 Antibody (1F4) [H00001912-M01] - Analysis of PHC2 expression in transfected 293T cell line by PHC2 monoclonal antibody (M01), clone 1F4.Lane 1: PHC2 transfected lysate (Predicted MW: 35.8 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1F4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HDC2/PHC2 Antibody (1F4) Summary

Immunogen
PHC2 (NP_004418.2, 91 a.a. - 200 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PYLQESKEEGAPLKLKCELCGRVDFAYKFKRSKRFCSMACAKRYNVGCTKRVGLFHSDRSKLQKAGAATHNRRRASKASLPPLTKDTKKQPTGTVPLSVTAALQLTHSQE
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PHC2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HDC2/PHC2 Antibody (1F4)

  • early development regulator 2 (homolog of polyhomeotic 2)
  • Early development regulatory protein 2
  • EDR2
  • HPH2
  • MGC163502
  • PH2
  • polyhomeotic 2
  • polyhomeotic homolog 2 (Drosophila)
  • polyhomeotic-like 2 (Drosophila)
  • polyhomeotic-like 2
  • polyhomeotic-like protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37371
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NBP1-89200
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-84896
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-33748
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37370
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP2-03348
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
21650002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF636
Species: Hu, Mu, Rt
Applications: WB, IHC
H00009261-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, PLA

Publications for HDC2/PHC2 Antibody (H00001912-M01) (0)

There are no publications for HDC2/PHC2 Antibody (H00001912-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HDC2/PHC2 Antibody (H00001912-M01) (0)

There are no reviews for HDC2/PHC2 Antibody (H00001912-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HDC2/PHC2 Antibody (H00001912-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HDC2/PHC2 Products

Bioinformatics Tool for HDC2/PHC2 Antibody (H00001912-M01)

Discover related pathways, diseases and genes to HDC2/PHC2 Antibody (H00001912-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HDC2/PHC2 Antibody (H00001912-M01)

Discover more about diseases related to HDC2/PHC2 Antibody (H00001912-M01).
 

Pathways for HDC2/PHC2 Antibody (H00001912-M01)

View related products by pathway.

PTMs for HDC2/PHC2 Antibody (H00001912-M01)

Learn more about PTMs related to HDC2/PHC2 Antibody (H00001912-M01).

Blogs on HDC2/PHC2

There are no specific blogs for HDC2/PHC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HDC2/PHC2 Antibody (1F4) and receive a gift card or discount.

Bioinformatics

Gene Symbol PHC2
Uniprot