Recombinant Human HBLD2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HBLD2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-129 of Human HBLD2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ISCA1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HBLD2 Protein

  • HESB like domain containing 2
  • HESB-like domain-containing protein 2
  • HISCA
  • hIscAmitochondrial
  • Iron-sulfur assembly protein IscA
  • iron-sulfur cluster assembly 1 homolog (S. cerevisiae)

Background

HBLD2( AAH02675, 1 a.a. - 130 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89716
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83611
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-94027
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4149
Species: Hu, Mu
Applications: WB
NBP2-46161
Species: Hu
Applications: WB, IHC
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-345
Species: Hu
Applications: WB, ChIP, IP
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NB100-81029
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-89897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006583-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-FrFl, IHC-WhMt
H00081689-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for HBLD2 Recombinant Protein (H00081689-P01) (0)

There are no publications for HBLD2 Recombinant Protein (H00081689-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HBLD2 Recombinant Protein (H00081689-P01) (0)

There are no reviews for HBLD2 Recombinant Protein (H00081689-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HBLD2 Recombinant Protein (H00081689-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HBLD2 Products

Bioinformatics Tool for HBLD2 Recombinant Protein (H00081689-P01)

Discover related pathways, diseases and genes to HBLD2 Recombinant Protein (H00081689-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HBLD2 Recombinant Protein (H00081689-P01)

Discover more about diseases related to HBLD2 Recombinant Protein (H00081689-P01).
 

Pathways for HBLD2 Recombinant Protein (H00081689-P01)

View related products by pathway.

Blogs on HBLD2

There are no specific blogs for HBLD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HBLD2 Antibody
NBP1-89715

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HBLD2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ISCA1