We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human GUCY2C GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human GUCY2C Protein [H00002984-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related GUCY2C Peptides and Proteins

Order Details


    • Catalog Number
      H00002984-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human GUCY2C GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 24-133 of Human GUCY2C

Source: Wheat Germ (in vitro)

Amino Acid Sequence: SQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNEGLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLIGPSCTYSTFQMYL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
GUCY2C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GUCY2C GST (N-Term) Protein

  • DIAR6
  • EC 4.6.1
  • GCC
  • GC-C
  • guanylate cyclase 2C (heat stable enterotoxin receptor)
  • Guanylate Cyclase C
  • Guanylyl Cyclase C
  • GUC2C
  • GUC2CEC 4.6.1.2
  • GUCY2C
  • heat-stable enterotoxin receptor
  • hSTAR
  • Intestinal guanylate cyclase
  • MUCIL
  • STA Receptor
  • StAR
  • STARSTA receptor

Background

GUCY2C - guanylate cyclase 2C (heat stable enterotoxin receptor)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89724
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-45631
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP2-92879
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-19151
Species: Bv, Hu, Ma
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-31333
Species: Hu, Mu, Rb, Rt
Applications: WB
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
NBP3-12239
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-87178
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-32353
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-78644
Species: Pm, Bv, Gt, Hu, Mu, Po, Pm, Rt, Sh
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB

Publications for GUCY2C Partial Recombinant Protein (H00002984-Q01) (0)

There are no publications for GUCY2C Partial Recombinant Protein (H00002984-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GUCY2C Partial Recombinant Protein (H00002984-Q01) (0)

There are no reviews for GUCY2C Partial Recombinant Protein (H00002984-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GUCY2C Partial Recombinant Protein (H00002984-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I am planning to order the GUCY2C partial recombinant protein (H00002984-Q01). Which monoclonal antibody works best with this protein? And does the protein react with the polyclonal antibody NBP1-81788 as well? Please let me know was soon as possible.
    • Unfortunately, we have not conducted testing of this protein with different antibodies, so we do not have data on which antibodies this protein is compatible with. We actually distribute this product for Abnova, a Taiwanese company. We would suggest that you choose from our Abnova antibodies (those with catalog numbers beginning in H), as this is likely to give you the best chances of success. I contacted Abnova to see if they had any recommendations as to which antibodies would be suitable for the H00002984-Q01 protein, and they have recommended the following antibodies (all of which we stock here at Novus) H00002984-Q01, H00002984-M02, H00002984-M04, H00002984-M04A, H00002984-M05, and H00002984-M05A.

Additional GUCY2C Products

Research Areas for GUCY2C Partial Recombinant Protein (H00002984-Q01)

Find related products by research area.

Blogs on GUCY2C

There are no specific blogs for GUCY2C, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GUCY2C GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GUCY2C