Recombinant Human GUCY2C Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GUCY2C Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human GUCY2C partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNEGLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLIGPSCTYSTFQMYL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GUCY2C

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GUCY2C Protein

  • EC 4.6.1
  • GC-C
  • guanylate cyclase 2C (heat stable enterotoxin receptor)
  • Guanylyl cyclase C
  • GUC2CEC 4.6.1.2
  • heat-stable enterotoxin receptor
  • hSTAR
  • Intestinal guanylate cyclase
  • STARSTA receptor

Background

GUCY2C - guanylate cyclase 2C (heat stable enterotoxin receptor)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89724
Species: Hu
Applications: WB, IHC, IHC-P
H00002981-T01
Species: Hu
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
NBP1-31333
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82538
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87178
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-32353
Species: Hu
Applications: WB, IHC, IHC-P
NB110-78644
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for GUCY2C Partial Recombinant Protein (H00002984-Q01) (0)

There are no publications for GUCY2C Partial Recombinant Protein (H00002984-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GUCY2C Partial Recombinant Protein (H00002984-Q01) (0)

There are no reviews for GUCY2C Partial Recombinant Protein (H00002984-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GUCY2C Partial Recombinant Protein (H00002984-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I am planning to order the GUCY2C partial recombinant protein (H00002984-Q01). Which monoclonal antibody works best with this protein? And does the protein react with the polyclonal antibody NBP1-81788 as well? Please let me know was soon as possible.
    • Unfortunately, we have not conducted testing of this protein with different antibodies, so we do not have data on which antibodies this protein is compatible with. We actually distribute this product for Abnova, a Taiwanese company. We would suggest that you choose from our Abnova antibodies (those with catalog numbers beginning in H), as this is likely to give you the best chances of success. I contacted Abnova to see if they had any recommendations as to which antibodies would be suitable for the H00002984-Q01 protein, and they have recommended the following antibodies (all of which we stock here at Novus) H00002984-Q01, H00002984-M02, H00002984-M04, H00002984-M04A, H00002984-M05, and H00002984-M05A.

Additional GUCY2C Products

Bioinformatics Tool for GUCY2C Partial Recombinant Protein (H00002984-Q01)

Discover related pathways, diseases and genes to GUCY2C Partial Recombinant Protein (H00002984-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GUCY2C Partial Recombinant Protein (H00002984-Q01)

Discover more about diseases related to GUCY2C Partial Recombinant Protein (H00002984-Q01).
 

Pathways for GUCY2C Partial Recombinant Protein (H00002984-Q01)

View related products by pathway.

PTMs for GUCY2C Partial Recombinant Protein (H00002984-Q01)

Learn more about PTMs related to GUCY2C Partial Recombinant Protein (H00002984-Q01).
 

Research Areas for GUCY2C Partial Recombinant Protein (H00002984-Q01)

Find related products by research area.

Blogs on GUCY2C

There are no specific blogs for GUCY2C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GUCY2C Antibody
NBP1-81788

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GUCY2C Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GUCY2C