Recombinant Human GUCY2C GST (N-Term) Protein Summary
| Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 24-133 of Human GUCY2C Source: Wheat Germ (in vitro) Amino Acid Sequence: SQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNEGLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLIGPSCTYSTFQMYL |
Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source |
Wheat germ |
| Protein/Peptide Type |
Partial Recombinant Protein |
| Gene |
GUCY2C |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- SDS-Page
- Western Blot
|
| Theoretical MW |
37.73 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human GUCY2C GST (N-Term) Protein
Background
GUCY2C - guanylate cyclase 2C (heat stable enterotoxin receptor)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu, RM
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Ma
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rb, Rt
Applications: WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Pm, Bv, Gt, Hu, Mu, Po, Pm, Rt, Sh
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Publications for GUCY2C Partial Recombinant Protein (H00002984-Q01) (0)
There are no publications for GUCY2C Partial Recombinant Protein (H00002984-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GUCY2C Partial Recombinant Protein (H00002984-Q01) (0)
There are no reviews for GUCY2C Partial Recombinant Protein (H00002984-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GUCY2C Partial Recombinant Protein (H00002984-Q01). (Showing 1 - 1 of 1 FAQ).
-
I am planning to order the GUCY2C partial recombinant protein (H00002984-Q01). Which monoclonal antibody works best with this protein? And does the protein react with the polyclonal antibody NBP1-81788 as well? Please let me know was soon as possible.
- Unfortunately, we have not conducted testing of this protein with different antibodies, so we do not have data on which antibodies this protein is compatible with. We actually distribute this product for Abnova, a Taiwanese company. We would suggest that you choose from our Abnova antibodies (those with catalog numbers beginning in H), as this is likely to give you the best chances of success. I contacted Abnova to see if they had any recommendations as to which antibodies would be suitable for the H00002984-Q01 protein, and they have recommended the following antibodies (all of which we stock here at Novus) H00002984-Q01, H00002984-M02, H00002984-M04, H00002984-M04A, H00002984-M05, and H00002984-M05A.
Additional GUCY2C Products
Research Areas for GUCY2C Partial Recombinant Protein (H00002984-Q01)
Find related products by research area.
|
Blogs on GUCY2C