Recombinant Human GTF2A2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GTF2A2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-109 of Human GTF2A2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE

Protein/Peptide Type
Recombinant Protein
Gene
GTF2A2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GTF2A2 Protein

  • General transcription factor IIA subunit 2
  • general transcription factor IIA, 2 (12kD subunit)
  • general transcription factor IIA, 2, 12kDa
  • HsT18745
  • TF2A2
  • TFIIA p12 subunit
  • TFIIA
  • TFIIA-12
  • TFIIA-gamma
  • TFIIAS
  • Transcription initiation factor IIA gamma chain
  • transcription initiation factor IIA subunit 2

Background

GTF2A2( AAH01919, 1 a.a. - 110 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01265
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-89922
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
AF6349
Species: Hu, Mu, Rt
Applications: WB
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
NBL1-11392
Species: Hu
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00011036-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
H00001810-B01P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
AF1334
Species: Hu
Applications: WB, IHC
NBP2-38188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
H00002958-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for GTF2A2 Recombinant Protein (H00002958-P01) (0)

There are no publications for GTF2A2 Recombinant Protein (H00002958-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTF2A2 Recombinant Protein (H00002958-P01) (0)

There are no reviews for GTF2A2 Recombinant Protein (H00002958-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GTF2A2 Recombinant Protein (H00002958-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GTF2A2 Products

Bioinformatics Tool for GTF2A2 Recombinant Protein (H00002958-P01)

Discover related pathways, diseases and genes to GTF2A2 Recombinant Protein (H00002958-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTF2A2 Recombinant Protein (H00002958-P01)

Discover more about diseases related to GTF2A2 Recombinant Protein (H00002958-P01).
 

Pathways for GTF2A2 Recombinant Protein (H00002958-P01)

View related products by pathway.

Blogs on GTF2A2

There are no specific blogs for GTF2A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GTF2A2 Antibody
NBP2-55408

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GTF2A2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF2A2