GSTM3 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

GSTM3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GSTM3.
  
  

  Source: E.coli

  Amino Acid Sequence: TYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINN

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: GSTM3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This peptide is useful as a blocking peptide for NBP1-83323.
  Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.
  
  For further blocking peptide related information and a protocol, click here.
• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for GSTM3 Recombinant Protein Antigen

• glutathione S-transferase mu 3 (brain)
• GST5Mu-3
• MGC3310
• MGC3704
• S-(hydroxyalkyl)glutathione lyase M3

Background

GSTM3, also known as Glutathione S-transferase Mu 3, is a 225 amino acid that is approx. 27 kDa; is responsible for conjugation of reduced glutathione to an extensive number of exogenous and endogenous hydrophobic electrophiles, and may be able to regulate uptake and detoxification of both endogenous compounds and xenobiotics at the testis and brain blood barriers. Current research is being performed on over 70 diseases and disorders including laryngeal squamous cell carcinoma, pharyngitis, laryngitis, squamous cell carcinoma, laryngeal cancer, oral cancer, cataract, colorectal cancer, carcinoma, breast cancer, astrocytoma, non-Hodgkin lymphoma, malignant pleural mesothelioma, open-angle glaucoma, Hodgkin's lymphoma, lung cancer, basal cell carcinoma, adult brain tumor, and leukoplakia. This protein has been shown to have interactions with over 70 proteins including RBL2, GSTM2, PAK2, MPG, and TFE3 in pathways such as glutathione metabolism, metabolism of xenobiotics by cytochrome P450, drug metabolism - cytochrome P450, establishment of blood-nerve barrier, and response to estrogen stimulus pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GSTM3