ZC3H3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZC3H3 Antibody [NBP1-81536] - Staining of human cell line A-431 shows positivity in golgi apparatus.
Immunohistochemistry-Paraffin: ZC3H3 Antibody [NBP1-81536] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZC3H3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GQLQPSRPTRARGTCSVEDPLLVCQKEPGKPRMVKSVGSVGDSPREPRRTVSESVIAVKASFPSSALPPRTGVALGRKLGSHSVASCAPQLLGDRRVGAGH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZC3H3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
ZC3H3 Protein (NBP1-81536PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZC3H3 Antibody

  • KIAA0150zinc finger CCCH-type domain containing 3
  • ZC3HDC3
  • zinc finger CCCH domain-containing protein 3
  • zinc finger CCCH type domain containing 3
  • zinc finger CCCH-type containing 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33422
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38421
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-91926
Species: Hu
Applications: IHC, IHC-P
NBP1-91861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-18891
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00084948-R01
Species: Hu
NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84951
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83708
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87689
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87243
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
20650002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-81536
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZC3H3 Antibody (NBP1-81536) (0)

There are no publications for ZC3H3 Antibody (NBP1-81536).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZC3H3 Antibody (NBP1-81536) (0)

There are no reviews for ZC3H3 Antibody (NBP1-81536). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZC3H3 Antibody (NBP1-81536) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZC3H3 Antibody Products

Related Products by Gene

Bioinformatics Tool for ZC3H3 Antibody (NBP1-81536)

Discover related pathways, diseases and genes to ZC3H3 Antibody (NBP1-81536). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ZC3H3 Antibody (NBP1-81536)

View related products by pathway.

Blogs on ZC3H3

There are no specific blogs for ZC3H3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZC3H3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZC3H3

Customers Who Bought This Also Bought