ZC3H3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZC3H3 Antibody [NBP1-81536] - Staining of human cell line A-431 shows positivity in golgi apparatus.
Immunohistochemistry-Paraffin: ZC3H3 Antibody [NBP1-81536] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

ZC3H3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GQLQPSRPTRARGTCSVEDPLLVCQKEPGKPRMVKSVGSVGDSPREPRRTVSESVIAVKASFPSSALPPRTGVALGRKLGSHSVASCAPQLLGDRRVGAGH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZC3H3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
ZC3H3 Protein (NBP1-81536PEP)

Alternate Names for ZC3H3 Antibody

  • KIAA0150zinc finger CCCH-type domain containing 3
  • ZC3HDC3
  • zinc finger CCCH domain-containing protein 3
  • zinc finger CCCH type domain containing 3
  • zinc finger CCCH-type containing 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00079792-T01
Species: Hu
H00009686-T01
Species: Hu
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-91926
Species: Hu
Applications: IHC, IHC-P
NBP1-91861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-18891
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00084948-R01
Species: Hu
NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84951
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83708
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87689
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-87243
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
20650002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-81536
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZC3H3 Antibody (NBP1-81536) (0)

There are no publications for ZC3H3 Antibody (NBP1-81536).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZC3H3 Antibody (NBP1-81536) (0)

There are no reviews for ZC3H3 Antibody (NBP1-81536). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZC3H3 Antibody (NBP1-81536) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZC3H3 Antibody Products

Related Products by Gene

Bioinformatics Tool for ZC3H3 Antibody (NBP1-81536)

Discover related pathways, diseases and genes to ZC3H3 Antibody (NBP1-81536). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ZC3H3 Antibody (NBP1-81536)

View related products by pathway.

Blogs on ZC3H3

There are no specific blogs for ZC3H3, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol ZC3H3

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-81536 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought