GRK7 Antibody

Immunocytochemistry/Immunofluorescence: GRK7 Antibody [NBP3-17500] - Staining of human cell line HeLa shows localization to mitochondria.

Immunohistochemistry-Paraffin: GRK7 Antibody [NBP3-17500] - Staining of human retina shows cytoplasmic positivity in photoreceptor layer, nerve fibers in outer plexiform layer and in nerve fiber layer. .

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

GRK7 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: EEGPTKDSALQGLVATCASAPAPGNPQPFLSQAVATKCQAATTEEERVAAVTLAKAEAMAFLQEQPFKDFVTSAFYDKFLQWKLFEMQPVSD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GRK7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation/Permeabilization: PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GRK7 Antibody

• EC 2.7.11
• EC 2.7.11.16
• G protein-coupled receptor kinase 7
• GPRK7
• GPRK7G protein-coupled receptor kinase GRK7
• GRK7

Background

GRK7 encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. It is specifically expressed in the retina and the encoded protein has been shown to phosphorylate cone opsins and initiate their deactivation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GRK7