GRK7 Antibody


Western Blot: GRK7 Antibody [NBP1-68989] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

GRK7 Antibody Summary

Synthetic peptides corresponding to GRK7 (G protein-coupled receptor kinase 7) The peptide sequence was selected from the C terminal of GRK7. Peptide sequence FFKNFATGAVPIAWQEEIIETGLFEELNDPNRPTGCEEGNSSKSGVCLLL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GRK7 and was validated on Western blot.
Theoretical MW
62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GRK7 Antibody

  • EC 2.7.11
  • EC
  • G protein-coupled receptor kinase 7
  • GPRK7
  • GPRK7G protein-coupled receptor kinase GRK7
  • GRK7


This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. It is specifically expressed in the retina and the encoded protein has been shown to phosphorylate cone opsins and initiate their deactivation.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, DirELISA
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: ICC/IF
Species: Hu
Species: Hu, Ze
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for GRK7 Antibody (NBP1-68989) (0)

There are no publications for GRK7 Antibody (NBP1-68989).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRK7 Antibody (NBP1-68989) (0)

There are no reviews for GRK7 Antibody (NBP1-68989). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRK7 Antibody (NBP1-68989) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GRK7 Products

Bioinformatics Tool for GRK7 Antibody (NBP1-68989)

Discover related pathways, diseases and genes to GRK7 Antibody (NBP1-68989). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRK7 Antibody (NBP1-68989)

Discover more about diseases related to GRK7 Antibody (NBP1-68989).

Pathways for GRK7 Antibody (NBP1-68989)

View related products by pathway.

PTMs for GRK7 Antibody (NBP1-68989)

Learn more about PTMs related to GRK7 Antibody (NBP1-68989).

Research Areas for GRK7 Antibody (NBP1-68989)

Find related products by research area.

Blogs on GRK7

There are no specific blogs for GRK7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GRK7 Antibody and receive a gift card or discount.


Gene Symbol GRK7