![Immunocytochemistry/Immunofluorescence: GRK2 Antibody [NBP2-57283] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/GRK2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57283-img0001.jpg "Immunocytochemistry/Immunofluorescence: GRK2 Antibody [NBP2-57283] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit GRK2 Antibody - BSA Free (NBP2-57283) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL |
| Predicted Species | Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GRK2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for GRK2 Antibody (NBP2-57283)Find related products by research area.
|
|
"Freeze!" - Arrestin Antibodies Used in New Serotonin Syndrome Study The beta-arrestin family regulate receptor binding of G-proteins, a group of seven transmembrane receptor proteins which includes the adrenergic, dopamine and serotonin receptors. Recently, arrestin antibodies were used in a study into Serotonin Syndr... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GRK2 |
![Western Blot GRK5 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRK5_AF4539_Western_Blot_5492.jpg)
![Knockout Validated GRK5 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRK5_AF4539_Knockout_Validated_22987.jpg)
![Flow Cytometry Lgr6 Antibody (918719) [Unconjugated]](https://images.novusbio.com/images2/Lgr6_MAB8458_Flow_Cytometry_16097.jpg)
![Immunocytochemistry Lgr6 Antibody (918719) [Unconjugated]](https://images.novusbio.com/images2/Lgr6_MAB8458_Immunocytochemistry_16415.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")