GRASP Antibody - BSA Free

Western Blot: GRASP Antibody [NBP2-85015] - WB Suggested Anti-Grasp Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Small Intestine

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GRASP Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of GRASP. Peptide sequence: FRWKNFTQSPEQQRKVLTLEKGDNQTFGFEIQTYGLHHREEQRVEMVTFV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAMALIN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GRASP Antibody - BSA Free

• GRP1 (general receptor for phosphoinositides 1)-associated scaffold protein
• MNCb-4428
• Tamalin

Background

PDZ domain-containing proteins, such as PSD-95 and GRIP are thought to play key roles in glutamate receptor plasticity. GRIP-associated proteins (GRASPs) that bind to distinct PDZ domains within GRIP also play key roles in regulation of glutamate receptor function. GRASP-1 is a neuronal rasGEF associated with GRIP and AMPA receptors in vivo. Recent work suggests that GRASP-1 may regulate neuronal ras signaling and contribute to the regulation of AMPA receptor distribution by NMDA receptor activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAMALIN