Granzyme M Antibody (4D11)

Images

 
Western Blot: Granzyme M Antibody (4D11) [H00003004-M03] - detection against Immunogen (38.1 KDa).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4D11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Granzyme M Antibody (4D11) Summary

Immunogen
GZMM (NP_005308, 85 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCL
Specificity
granzyme M (lymphocyte met-ase 1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GZMM
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00003004-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Granzyme M Antibody (4D11)

  • EC 3.4.21
  • EC 3.4.21.-
  • granzyme M (lymphocyte met-ase 1)
  • granzyme M
  • Hu-Met-1
  • LMET1
  • lymphocyte met-ase 1
  • Met-1 serine protease
  • MET1met-ase
  • Met-ase
  • Natural killer cell granular protease

Background

Human natural killer (NK) cells and activated lymphocytes express and store a distinct subset of neutral serine proteases together with proteoglycans and other immune effector molecules in large cytoplasmic granules. These serine proteases are collectively termed granzymes and include 4 distinct gene products: granzyme A, granzyme B, granzyme H, and Met-ase, also known as granzyme M.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2905
Species: Hu
Applications: WB, ELISA, ICC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33498
Species: Hu
Applications: IHC, IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po, Bv, Sh
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC, IHC-FrFl, KD
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-81245
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61879
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-93879
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for Granzyme M Antibody (H00003004-M03)(1)

Reviews for Granzyme M Antibody (H00003004-M03) (0)

There are no reviews for Granzyme M Antibody (H00003004-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Granzyme M Antibody (H00003004-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Granzyme M Products

Bioinformatics Tool for Granzyme M Antibody (H00003004-M03)

Discover related pathways, diseases and genes to Granzyme M Antibody (H00003004-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Granzyme M Antibody (H00003004-M03)

Discover more about diseases related to Granzyme M Antibody (H00003004-M03).
 

Pathways for Granzyme M Antibody (H00003004-M03)

View related products by pathway.

PTMs for Granzyme M Antibody (H00003004-M03)

Learn more about PTMs related to Granzyme M Antibody (H00003004-M03).
 

Research Areas for Granzyme M Antibody (H00003004-M03)

Find related products by research area.

Blogs on Granzyme M

There are no specific blogs for Granzyme M, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Granzyme M Antibody (4D11) and receive a gift card or discount.

Bioinformatics

Gene Symbol GZMM
Entrez
OMIM
Uniprot