Granzyme K Recombinant Protein Antigen

Images

 
There are currently no images for Granzyme K Recombinant Protein Antigen (NBP2-49387PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Granzyme K Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Granzyme K.

Source: E. coli

Amino Acid Sequence: KCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GZMK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49387.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Granzyme K Recombinant Protein Antigen

  • EC 3.4.21
  • EC 3.4.21.-
  • EC 3.4.21.4
  • Fragmentin-3
  • Granzyme 3
  • granzyme K (granzyme 3; tryptase II)
  • granzyme K (serine protease, granzyme 3; tryptase II)
  • Granzyme K
  • Granzyme-3
  • Granzyme-K
  • GZMK
  • NK-Tryp-2
  • NK-Tryptase-2
  • PRSS
  • TRYP2
  • TRYP2granzyme-3
  • Tryptase II

Background

The granzyme family of proteins belong to the larger peptidase S1 family. Granzyme A and granzyme B are serine proteases that facilitate apoptotic signaling in cytotoxic T lymphocytes (CTL) and natural killer (NK) cells. Within the granules of activated CTLs, granzyme A and B are processed and converted to their active forms by the lysosomal cysteine protease cathepsin C. Once cleaved, these active proteases target distinct substrates for proteolysis and, thereby, mediate apoptosis through two different pathways. Granzyme H localizes to cytoplasmic granules of cytolytic T lymphocytes and is important for target cell lysis in cell-mediated immune responses. Granzyme K (GMZK), also designated granzyme-3 or NK-tryptase-2 (NK-TRYP-2), contains one peptidase S1 domain. Granzyme K is a serine protease localizing to the granules of natural killer cells and cytotoxic T lymphocytes. It is primarily expressed in thymus, lung, spleen and peripheral blood leukocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2905
Species: Hu
Applications: ELISA, ICC, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NBP2-26444
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, mIF, WB
202-IL
Species: Hu
Applications: BA
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-62583
Species: Hu
Applications: WB
NBP3-47902
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
AF1034
Species: Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NB100-74635
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
AF2408
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
NB100-56565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB

Publications for Granzyme K Recombinant Protein Antigen (NBP2-49387PEP) (0)

There are no publications for Granzyme K Recombinant Protein Antigen (NBP2-49387PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Granzyme K Recombinant Protein Antigen (NBP2-49387PEP) (0)

There are no reviews for Granzyme K Recombinant Protein Antigen (NBP2-49387PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Granzyme K Recombinant Protein Antigen (NBP2-49387PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Granzyme K Products

Research Areas for Granzyme K Recombinant Protein Antigen (NBP2-49387PEP)

Find related products by research area.

Blogs on Granzyme K

There are no specific blogs for Granzyme K, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Granzyme K Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GZMK