GPT Recombinant Protein Antigen

Images

 
There are currently no images for GPT Recombinant Protein Antigen (NBP1-89111PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GPT Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPT.

Source: E. coli

Amino Acid Sequence: MASSTGDRSQAVRNGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GPT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89111.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GPT Recombinant Protein Antigen

  • AAT1alanine aminotransferase 1
  • ALT1
  • ALT1EC 2.6.1.2
  • Glutamate pyruvate transaminase 1
  • glutamic-alanine transaminase 1
  • Glutamic--alanine transaminase 1
  • glutamic-pyruvate transaminase (alanine aminotransferase)
  • Glutamic--pyruvic transaminase 1
  • GPT1GPT 1

Background

GPT, also known as Alanine aminotransferase 1, is a 496 amino acid that is 55 kDa, cytoplasm located, most commonly found in liver, kidney, heart, and skeletal muscles; acts as a catalyzer of the reversible transamination between alanine and 2-oxoglutarate to compose pyruvate and glutamate, is involved in cellular nitrogen metabolism, and also in liver gluconeogenesis starting with precursors transported from skeletal muscles. Current research is being performed on several diseases and disorders including vitelliform macular dystrophy, liver disease, epidemic typhus, pyomyositis, kidney cortex necrosis, scrub typhus, hepatitis e, hepatitis c, iron overload hepatitis b, glucose intolerance, biliary atresia, alcohol abuse, cholangitis, cholecystitis, hellp syndrome, viral hepatitis, siderosis, choledocholithiasis, hepatitis a, kawasaki disease, wilson disease, and hepatic encephalopathy. This protein has shown to have interactions with CAPN1, CAPN3, HSPD1, THNSL2, GPT2, AND PSAT1 in pathways such as alanine, aspartate and glutamate metabolism, amino acid synthesis and interconversion (transamination), and metabolism of amino acids and derivatives.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
DPI00
Species: Hu
Applications: ELISA
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
NBP2-92749
Species: Hu, Mu
Applications: WB
DCC270
Species: Hu
Applications: ELISA
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-15742
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-25358
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00002678-M01
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP2-46395
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-82847
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-01506
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-87069
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP2-45978
Species: Hu
Applications: Flow, IHC, IHC-P, WB

Publications for GPT Recombinant Protein Antigen (NBP1-89111PEP) (0)

There are no publications for GPT Recombinant Protein Antigen (NBP1-89111PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPT Recombinant Protein Antigen (NBP1-89111PEP) (0)

There are no reviews for GPT Recombinant Protein Antigen (NBP1-89111PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GPT Recombinant Protein Antigen (NBP1-89111PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GPT Products

Blogs on GPT

There are no specific blogs for GPT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GPT Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GPT