GPT Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPT. Source: E. coli
Amino Acid Sequence: FRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDPSFAQFQAEKQAVLAE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
GPT |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89110. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for GPT Recombinant Protein Antigen
Background
GPT, also known as Alanine aminotransferase 1, is a 496 amino acid that is 55 kDa, cytoplasm located, most commonly found in liver, kidney, heart, and skeletal muscles; acts as a catalyzer of the reversible transamination between alanine and 2-oxoglutarate to compose pyruvate and glutamate, is involved in cellular nitrogen metabolism, and also in liver gluconeogenesis starting with precursors transported from skeletal muscles. Current research is being performed on several diseases and disorders including vitelliform macular dystrophy, liver disease, epidemic typhus, pyomyositis, kidney cortex necrosis, scrub typhus, hepatitis e, hepatitis c, iron overload hepatitis b, glucose intolerance, biliary atresia, alcohol abuse, cholangitis, cholecystitis, hellp syndrome, viral hepatitis, siderosis, choledocholithiasis, hepatitis a, kawasaki disease, wilson disease, and hepatic encephalopathy. This protein has shown to have interactions with CAPN1, CAPN3, HSPD1, THNSL2, GPT2, AND PSAT1 in pathways such as alanine, aspartate and glutamate metabolism, amino acid synthesis and interconversion (transamination), and metabolism of amino acids and derivatives.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
Species: Hu, Mu
Applications: ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Publications for GPT Recombinant Protein Antigen (NBP1-89110PEP) (0)
There are no publications for GPT Recombinant Protein Antigen (NBP1-89110PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GPT Recombinant Protein Antigen (NBP1-89110PEP) (0)
There are no reviews for GPT Recombinant Protein Antigen (NBP1-89110PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for GPT Recombinant Protein Antigen (NBP1-89110PEP) (0)
Additional GPT Products
Blogs on GPT