GPT Antibody - BSA Free

Western Blot: GPT Antibody [NBP1-53177] - Titration: 5.0ug/ml Positive Control: Fetal liver cell lysate.

Immunohistochemistry-Paraffin: GPT Antibody [NBP1-53177] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.

Product Discontinued

GPT Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human GPT (NP_005300). Peptide sequence RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPT
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1.0 ug/ml
• Theoretical MW: 55 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 23595987).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for GPT Antibody - BSA Free

• AAT1alanine aminotransferase 1
• ALT1
• ALT1EC 2.6.1.2
• Glutamate pyruvate transaminase 1
• glutamic-alanine transaminase 1
• Glutamic--alanine transaminase 1
• glutamic-pyruvate transaminase (alanine aminotransferase)
• Glutamic--pyruvic transaminase 1
• GPT1GPT 1

Background

GPT participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GPT Antibody (NBP1-53177)(1)

Publication using NBP1-53177

• Erion DM, Kotas ME, McGlashon J et al. cAMP-responsive Element-binding Protein (CREB)-regulated Transcription Coactivator 2 (CRTC2) Promotes Glucagon Clearance and Hepatic Amino Acid Catabolism to Regulate Glucose Homeostasis. J Biol Chem 2013-05-31 [PMID: 23595987] (WB, Rat)

Bioinformatics

• Gene Symbol: GPT
• Entrez:
  • 2875(Human)
• Uniprot:
  • P24298(Human)