GPT Antibody

Images

 
Western Blot: GPT Antibody [NBP1-53177] - Titration: 5.0ug/ml Positive Control: Fetal liver cell lysate.
Immunohistochemistry-Paraffin: GPT Antibody [NBP1-53177] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPT Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human GPT (NP_005300). Peptide sequence RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPT
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against GPT and was validated on Western Blot and immunohistochemistry-P
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-53177 in the following applications:

  • WB
    1 publication

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 23595987).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GPT Antibody

  • AAT1alanine aminotransferase 1
  • ALT1
  • ALT1EC 2.6.1.2
  • Glutamate pyruvate transaminase 1
  • glutamic-alanine transaminase 1
  • Glutamic--alanine transaminase 1
  • glutamic-pyruvate transaminase (alanine aminotransferase)
  • Glutamic--pyruvic transaminase 1
  • GPT1GPT 1

Background

GPT participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
DPI00
Species: Hu
Applications: ELISA
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DCC270
Species: Hu
Applications: ELISA
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-32263
Species: Hu, Mu
Applications: IHC, IP, WB
NBP1-89134
Species: Hu
Applications: IHC, IHC-P
H00002678-M01
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP2-46395
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-82847
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-01506
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-87069
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP2-74045
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB

Publications for GPT Antibody (NBP1-53177)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for GPT Antibody (NBP1-53177) (0)

There are no reviews for GPT Antibody (NBP1-53177). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPT Antibody (NBP1-53177) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPT Products

Bioinformatics Tool for GPT Antibody (NBP1-53177)

Discover related pathways, diseases and genes to GPT Antibody (NBP1-53177). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPT Antibody (NBP1-53177)

Discover more about diseases related to GPT Antibody (NBP1-53177).
 

Pathways for GPT Antibody (NBP1-53177)

View related products by pathway.

PTMs for GPT Antibody (NBP1-53177)

Learn more about PTMs related to GPT Antibody (NBP1-53177).

Blogs on GPT

There are no specific blogs for GPT, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPT
Entrez
Uniprot