Recombinant Human GPSM1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GPSM1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-166 of Human GPSM1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDDQRCPLDDGQAGAAEATAAPTLEDRIAQPSMTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDFFNMLIKYQSSRIDDQRCPPPDVLPRGPTMPDEDFFSLIQRVQAKRMDEQRVDLAGGPEQGAGGPPEPQQQCQPGAS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
GPSM1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GPSM1 Protein

  • 1810037C22Rik
  • C. elegans)
  • DKFZp727I051
  • G-protein signaling modulator 1
  • G-protein-signaling modulator 1

Background

G proteins propagate intracellular signals initiated by G protein-coupled receptors. GPSM1, a receptor-independent activator of G protein signaling, is one of several factors that influence the basal activity of G protein signaling systems (Pizzinat et al., 2001 [PubMed 11278352]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-53125
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29617
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-24516
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-02004
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77082
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP2-56179
Species: Hu
Applications: ICC/IF
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-90279
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15294
Species: Hu, Mu
Applications: WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90980
Species: Hu
Applications: IHC, IHC-P
H00026086-P02
Species: Hu
Applications: WB, ELISA, PA

Publications for GPSM1 Recombinant Protein (H00026086-P02) (0)

There are no publications for GPSM1 Recombinant Protein (H00026086-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPSM1 Recombinant Protein (H00026086-P02) (0)

There are no reviews for GPSM1 Recombinant Protein (H00026086-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPSM1 Recombinant Protein (H00026086-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GPSM1 Products

Bioinformatics Tool for GPSM1 Recombinant Protein (H00026086-P02)

Discover related pathways, diseases and genes to GPSM1 Recombinant Protein (H00026086-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPSM1 Recombinant Protein (H00026086-P02)

Discover more about diseases related to GPSM1 Recombinant Protein (H00026086-P02).
 

Pathways for GPSM1 Recombinant Protein (H00026086-P02)

View related products by pathway.

PTMs for GPSM1 Recombinant Protein (H00026086-P02)

Learn more about PTMs related to GPSM1 Recombinant Protein (H00026086-P02).

Blogs on GPSM1

There are no specific blogs for GPSM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TPR Antibody
NB100-2866
GPSM1 Antibody
NBP1-91968

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GPSM1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GPSM1