GPRIN2 Antibody

Immunocytochemistry/Immunofluorescence: GPRIN2 Antibody [NBP2-47444] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm.

Immunohistochemistry: GPRIN2 Antibody [NBP2-47444] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.

Product Discontinued

GPRIN2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QAEPKAAEQLATTTCHALPPAALLCGMREMREVGAGGCCHALPATGILAFPKLVASVSESGLQAQHGVKIHCRL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPRIN2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GPRIN2 Antibody

• G protein regulated inducer of neurite outgrowth 2
• G protein-regulated inducer of neurite outgrowth 2
• GRIN2
• KIAA0514MGC15171

Background

GPRIN2 may be involved in neurite outgrowth

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPRIN2