GPRC5C Antibody - BSA Free

Immunohistochemistry-Paraffin: GPRC5C Antibody [NBP1-87159] - Analysis in human stomach and tonsil tissues. Corresponding GPRC5C RNA-seq data are presented for the same tissues.

Western Blot: GPRC5C Antibody [NBP1-87159] - Western blot analysis in control (vector only transfected HEK293T lysate) and GPRC5C over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells,

Immunohistochemistry-Paraffin: GPRC5C Antibody [NBP1-87159] - Staining of human stomach shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: GPRC5C Antibody [NBP1-87159] - Staining of human tonsil shows no positivity in lymphoid cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GPRC5C Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GPRC5C Antibody - BSA Free (NBP1-87159) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQAATPPKDGKNSQVFRN
• Predicted Species: Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPRC5C
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-P HIER pH6 retrieval is recommended.
• Control Peptide:

  GPRC5C Protein (NBP1-87159PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GPRC5C Antibody - BSA Free

• G protein-coupled receptor, family C, group 5, member C
• GPRC5C
• MGC131820
• RAIG3
• RAIG-3G-protein coupled receptor family C group 5 member C
• RAIG3orphan G-protein coupled receptor
• retinoic acid responsive gene protein
• Retinoic acid-induced gene 3 protein

Background

GPRC5C is encoded by this gene is a member of the type 3 G protein-coupled receptor family. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. The specific function of this protein is unknown; however, this protein may mediate the cellular effects of retinoic acid on the G protein signal transduction cascade. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPRC5C
• Entrez:
  • 55890(Human)
• Uniprot:
  • Q9NQ84()